Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   EL130_RS00595 Genome accession   NZ_LR134320
Coordinates   109799..110029 (-) Length   76 a.a.
NCBI ID   WP_002283381.1    Uniprot ID   -
Organism   Streptococcus mutans strain NCTC10832     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context

Location: 104799..115029
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EL130_RS00545 (NCTC10832_00102) - 105009..105197 (-) 189 WP_002270918.1 Blp family class II bacteriocin -
  EL130_RS00550 (NCTC10832_00103) - 105361..105573 (-) 213 WP_002264173.1 Blp family class II bacteriocin -
  EL130_RS10370 - 105653..105784 (+) 132 WP_002285725.1 hypothetical protein -
  EL130_RS00560 (NCTC10832_00104) - 105978..106142 (-) 165 WP_002265308.1 hypothetical protein -
  EL130_RS10270 - 106582..106794 (+) 213 Protein_103 IS3 family transposase -
  EL130_RS00575 (NCTC10832_00105) - 106917..107321 (-) 405 WP_002263912.1 hypothetical protein -
  EL130_RS00580 (NCTC10832_00106) - 107468..107887 (-) 420 WP_002263913.1 hypothetical protein -
  EL130_RS00590 (NCTC10832_00107) - 109267..109668 (-) 402 WP_002310604.1 hypothetical protein -
  EL130_RS00595 (NCTC10832_00108) cipB 109799..110029 (-) 231 WP_002283381.1 Blp family class II bacteriocin Regulator
  EL130_RS00600 (NCTC10832_00109) comC/blpC 110297..110428 (+) 132 WP_002273928.1 ComC/BlpC family leader-containing pheromone/bacteriocin Regulator
  EL130_RS00605 (NCTC10832_00110) comD/blpH 110597..111922 (-) 1326 WP_002277687.1 sensor histidine kinase Regulator
  EL130_RS00610 (NCTC10832_00111) comE/blpR 111919..112671 (-) 753 WP_002277686.1 response regulator transcription factor Regulator
  EL130_RS00615 (NCTC10832_00112) - 113136..113774 (-) 639 WP_002262115.1 VTT domain-containing protein -
  EL130_RS00620 (NCTC10832_00113) - 113822..114448 (-) 627 WP_002277685.1 hypothetical protein -

Sequence

Protein


Download         Length: 76 a.a.        Molecular weight: 7276.10 Da        Isoelectric Point: 3.7781

>NTDB_id=1121383 EL130_RS00595 WP_002283381.1 109799..110029(-) (cipB) [Streptococcus mutans strain NCTC10832]
MNTQAFEQFNVMDNEALSAIEGGGRGWNCAAGIALGAGQGYMATAGGTAFLGPYAIGTGAFGAIAGGIGGALNSCG

Nucleotide


Download         Length: 231 bp        

>NTDB_id=1121383 EL130_RS00595 WP_002283381.1 109799..110029(-) (cipB) [Streptococcus mutans strain NCTC10832]
ATGAATACACAAGCATTTGAACAATTTAACGTAATGGATAATGAAGCACTTTCAGCTATTGAAGGTGGGGGCCGCGGATG
GAATTGTGCAGCAGGTATTGCTCTAGGTGCTGGGCAAGGTTATATGGCTACTGCAGGCGGTACAGCATTTCTTGGTCCAT
ATGCTATTGGCACTGGTGCCTTTGGGGCTATTGCTGGAGGAATCGGAGGAGCTCTTAATTCCTGTGGTTAG

Domains

Predicted by InterproScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(6-68)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

98.684

100

0.987

Multiple sequence alignment