Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   EL107_RS04995 Genome accession   NZ_LR134314
Coordinates   978594..979085 (-) Length   163 a.a.
NCBI ID   WP_002983122.1    Uniprot ID   A0A9X8XIP7
Organism   Streptococcus pyogenes strain NCTC8302     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 937768..1004526 978594..979085 within 0


Gene organization within MGE regions


Location: 937768..1004526
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EL107_RS04750 (NCTC8302_00948) prx 937768..937950 (-) 183 WP_047149504.1 hypothetical protein Regulator
  EL107_RS04755 (NCTC8302_00950) - 938647..939852 (-) 1206 WP_126409747.1 glucosaminidase domain-containing protein -
  EL107_RS04760 (NCTC8302_00952) - 939975..940202 (-) 228 WP_029714020.1 phage holin -
  EL107_RS04765 (NCTC8302_00953) - 940199..940471 (-) 273 WP_011017397.1 hypothetical protein -
  EL107_RS04770 (NCTC8302_00954) - 940483..941121 (-) 639 WP_046735270.1 hypothetical protein -
  EL107_RS04775 (NCTC8302_00955) - 941124..941552 (-) 429 WP_002988448.1 DUF1617 family protein -
  EL107_RS04780 (NCTC8302_00956) - 941564..943468 (-) 1905 WP_126409749.1 gp58-like family protein -
  EL107_RS04785 (NCTC8302_00957) - 943483..944598 (-) 1116 WP_011888927.1 hyaluronoglucosaminidase -
  EL107_RS04790 (NCTC8302_00958) - 944595..946574 (-) 1980 WP_011888928.1 phage tail protein -
  EL107_RS04795 (NCTC8302_00959) - 946584..947426 (-) 843 WP_011054865.1 phage tail family protein -
  EL107_RS04800 (NCTC8302_00960) - 947438..951820 (-) 4383 WP_126409752.1 tape measure protein -
  EL107_RS04805 (NCTC8302_00961) - 951835..952068 (-) 234 WP_011888930.1 hypothetical protein -
  EL107_RS04810 (NCTC8302_00962) - 952143..952598 (-) 456 WP_011888931.1 tail assembly chaperone -
  EL107_RS04815 (NCTC8302_00963) - 952652..953251 (-) 600 WP_011054869.1 phage major tail protein, TP901-1 family -
  EL107_RS04820 (NCTC8302_00964) - 953263..953622 (-) 360 WP_011054870.1 hypothetical protein -
  EL107_RS04825 (NCTC8302_00965) - 953626..953970 (-) 345 WP_011106640.1 HK97-gp10 family putative phage morphogenesis protein -
  EL107_RS04830 (NCTC8302_00966) - 953967..954245 (-) 279 WP_011054872.1 hypothetical protein -
  EL107_RS04835 (NCTC8302_00967) - 954256..954612 (-) 357 WP_011888932.1 phage head-tail connector protein -
  EL107_RS04840 (NCTC8302_00968) - 954624..955511 (-) 888 WP_002983429.1 hypothetical protein -
  EL107_RS04845 (NCTC8302_00969) - 955524..956093 (-) 570 WP_011888933.1 DUF4355 domain-containing protein -
  EL107_RS04850 (NCTC8302_00970) - 956255..956521 (-) 267 WP_011888934.1 hypothetical protein -
  EL107_RS04855 - 956526..956714 (-) 189 WP_011054876.1 hypothetical protein -
  EL107_RS04860 (NCTC8302_00972) - 956742..958190 (-) 1449 WP_032465703.1 minor capsid protein -
  EL107_RS04865 (NCTC8302_00973) - 958150..959682 (-) 1533 WP_038433243.1 phage portal protein -
  EL107_RS04870 (NCTC8302_00974) - 959698..960975 (-) 1278 WP_011054879.1 PBSX family phage terminase large subunit -
  EL107_RS04875 (NCTC8302_00975) - 960965..961417 (-) 453 WP_011106637.1 terminase small subunit -
  EL107_RS04880 (NCTC8302_00976) - 961507..961923 (-) 417 WP_011054881.1 transcriptional regulator -
  EL107_RS04885 (NCTC8302_00978) - 962056..962328 (-) 273 WP_011054882.1 hypothetical protein -
  EL107_RS09445 (NCTC8302_00979) - 962321..962491 (-) 171 WP_011054883.1 hypothetical protein -
  EL107_RS04890 (NCTC8302_00980) - 962492..963814 (-) 1323 WP_047149508.1 SNF2-related protein -
  EL107_RS04895 (NCTC8302_00981) - 963811..964086 (-) 276 WP_011054885.1 VRR-NUC domain-containing protein -
  EL107_RS04900 (NCTC8302_00982) - 964472..966856 (-) 2385 WP_047149509.1 phage/plasmid primase, P4 family -
  EL107_RS04905 (NCTC8302_00983) - 966861..968783 (-) 1923 WP_047149510.1 DNA polymerase -
  EL107_RS04910 (NCTC8302_00984) - 968826..969389 (-) 564 WP_086934854.1 DUF2815 family protein -
  EL107_RS04915 (NCTC8302_00985) - 969398..970555 (-) 1158 WP_011888943.1 DUF2800 domain-containing protein -
  EL107_RS04920 (NCTC8302_00986) - 970555..970855 (-) 301 Protein_954 hypothetical protein -
  EL107_RS04925 (NCTC8302_00988) - 970943..971146 (-) 204 WP_030127426.1 hypothetical protein -
  EL107_RS04930 (NCTC8302_00990) - 971292..971679 (-) 388 Protein_956 hypothetical protein -
  EL107_RS04935 (NCTC8302_00991) - 971676..971879 (-) 204 WP_047149512.1 hypothetical protein -
  EL107_RS04940 (NCTC8302_00992) - 971872..972042 (-) 171 WP_023611037.1 hypothetical protein -
  EL107_RS04945 (NCTC8302_00993) - 972071..972328 (-) 258 WP_047149513.1 hypothetical protein -
  EL107_RS04950 (NCTC8302_00994) - 972416..972616 (-) 201 WP_227868729.1 hypothetical protein -
  EL107_RS04955 (NCTC8302_00995) - 972667..972858 (-) 192 WP_001283052.1 hypothetical protein -
  EL107_RS04960 (NCTC8302_00996) - 973499..973849 (+) 351 WP_011184049.1 helix-turn-helix domain-containing protein -
  EL107_RS04965 (NCTC8302_00997) - 973863..974246 (+) 384 WP_047149515.1 ImmA/IrrE family metallo-endopeptidase -
  EL107_RS04970 (NCTC8302_00998) - 974257..974808 (+) 552 WP_047149516.1 hypothetical protein -
  EL107_RS04975 (NCTC8302_00999) - 974984..976081 (+) 1098 WP_047149517.1 site-specific integrase -
  EL107_RS04980 (NCTC8302_01000) - 976325..977269 (+) 945 WP_002983147.1 magnesium transporter CorA family protein -
  EL107_RS04985 (NCTC8302_01001) - 977401..978057 (+) 657 WP_002983144.1 DUF1129 domain-containing protein -
  EL107_RS04990 (NCTC8302_01002) rpsR 978190..978429 (-) 240 WP_002983142.1 30S ribosomal protein S18 -
  EL107_RS04995 (NCTC8302_01003) ssb 978594..979085 (-) 492 WP_002983122.1 single-stranded DNA-binding protein Machinery gene
  EL107_RS05000 (NCTC8302_01004) rpsF 979107..979397 (-) 291 WP_002983117.1 30S ribosomal protein S6 -
  EL107_RS05005 (NCTC8302_01005) - 979570..979863 (-) 294 WP_002983113.1 hypothetical protein -
  EL107_RS05010 (NCTC8302_01006) mutY 980031..981185 (+) 1155 WP_002988276.1 A/G-specific adenine glycosylase -
  EL107_RS05015 (NCTC8302_01007) - 981350..981874 (+) 525 Protein_973 helix-turn-helix domain-containing protein -
  EL107_RS05020 (NCTC8302_01008) trxA 981926..982240 (-) 315 WP_001162959.1 thioredoxin -
  EL107_RS05025 (NCTC8302_01009) - 982321..982821 (-) 501 WP_126409754.1 phosphatase PAP2 family protein -
  EL107_RS05030 (NCTC8302_01010) - 982825..985164 (-) 2340 WP_023078038.1 endonuclease MutS2 -
  EL107_RS05035 (NCTC8302_01011) - 985313..985858 (-) 546 WP_011184926.1 CvpA family protein -
  EL107_RS05040 (NCTC8302_01012) - 985861..986169 (-) 309 WP_002993251.1 hypothetical protein -
  EL107_RS05045 (NCTC8302_01013) rnhC 986326..987228 (+) 903 WP_010922635.1 ribonuclease HIII -
  EL107_RS05050 (NCTC8302_01014) lepB 987239..987832 (+) 594 WP_002983074.1 signal peptidase I -
  EL107_RS05055 (NCTC8302_01015) - 987890..990343 (+) 2454 WP_011184928.1 ATP-dependent RecD-like DNA helicase -
  EL107_RS05060 (NCTC8302_01016) - 990434..990916 (+) 483 WP_002983066.1 hypothetical protein -
  EL107_RS05065 (NCTC8302_01017) dinB 991009..992103 (-) 1095 WP_002983063.1 DNA polymerase IV -
  EL107_RS05070 (NCTC8302_01018) pflB 992312..994639 (+) 2328 WP_002988233.1 formate C-acetyltransferase -
  EL107_RS05075 (NCTC8302_01019) - 994819..995769 (-) 951 WP_011018196.1 serine hydrolase domain-containing protein -
  EL107_RS05080 (NCTC8302_01020) - 995754..996506 (-) 753 WP_011184930.1 CppA N-terminal domain-containing protein -
  EL107_RS05085 (NCTC8302_01021) - 996804..997700 (+) 897 WP_002983050.1 sulfite exporter TauE/SafE family protein -
  EL107_RS05090 (NCTC8302_01022) gla 998036..998884 (-) 849 WP_002983047.1 aquaglyceroporin Gla -
  EL107_RS05105 (NCTC8302_01023) - 999356..1000552 (-) 1197 WP_002993271.1 MFS transporter -
  EL107_RS05110 (NCTC8302_01024) - 1000718..1001377 (+) 660 WP_023078539.1 Crp/Fnr family transcriptional regulator -
  EL107_RS05115 (NCTC8302_01025) - 1001399..1003681 (+) 2283 WP_011184932.1 Xaa-Pro dipeptidyl-peptidase -
  EL107_RS05120 (NCTC8302_01026) - 1003761..1003982 (-) 222 WP_002988211.1 helix-turn-helix domain-containing protein -
  EL107_RS05125 (NCTC8302_01027) - 1004152..1004526 (+) 375 WP_002992262.1 helix-turn-helix domain-containing protein -

Sequence


Protein


Download         Length: 163 a.a.        Molecular weight: 17981.76 Da        Isoelectric Point: 4.8894

>NTDB_id=1121133 EL107_RS04995 WP_002983122.1 978594..979085(-) (ssb) [Streptococcus pyogenes strain NCTC8302]
MINNVVLVGRMTKDAELRYTPSQVAVATFTLAVNRTFKSQNGEREADFINCVIWRQPAENLANWAKKGALIGVTGRIQTR
NYENQQGQRVYVTEVVADNFQMLESRATREGGSTGSFNGGFNNNTSSSNSYSAPAQQTPNFGRDDSPFGNSNPMDISDDD
LPF

Nucleotide


Download         Length: 492 bp        

>NTDB_id=1121133 EL107_RS04995 WP_002983122.1 978594..979085(-) (ssb) [Streptococcus pyogenes strain NCTC8302]
ATGATTAATAATGTAGTACTAGTTGGTCGTATGACCAAGGATGCAGAACTTCGTTACACACCAAGTCAAGTAGCTGTGGC
TACCTTCACACTTGCTGTTAACCGTACCTTTAAAAGCCAAAATGGTGAACGCGAGGCAGATTTCATTAACTGTGTGATCT
GGCGTCAACCGGCTGAAAATTTAGCGAACTGGGCTAAAAAAGGTGCCTTGATCGGAGTTACGGGTCGTATTCAGACACGT
AACTACGAAAACCAACAAGGACAACGTGTCTATGTAACAGAAGTTGTTGCAGATAATTTCCAAATGTTGGAAAGTCGTGC
TACACGTGAAGGTGGCTCAACTGGCTCATTTAATGGTGGTTTTAACAATAACACTTCATCATCAAACAGTTACTCAGCGC
CTGCACAACAAACGCCTAACTTTGGAAGAGATGATAGCCCATTTGGGAACTCAAACCCGATGGATATCTCAGATGACGAT
CTTCCATTCTAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Latilactobacillus sakei subsp. sakei 23K

59.884

100

0.632

  ssbA Bacillus subtilis subsp. subtilis str. 168

59.195

100

0.632

  ssbB Bacillus subtilis subsp. subtilis str. 168

57.547

65.031

0.374

  ssbB/cilA Streptococcus pneumoniae TIGR4

54.128

66.871

0.362


Multiple sequence alignment