Detailed information    

insolico Bioinformatically predicted

Overview

Name   comC/comC1   Type   Regulator
Locus tag   EL078_RS08395 Genome accession   NZ_LR134282
Coordinates   1680300..1680455 (+) Length   51 a.a.
NCBI ID   WP_126438121.1    Uniprot ID   -
Organism   Streptococcus equinus strain NCTC8140     
Function   binding to ComD; induce autophosphorylation of ComD (predicted from homology)   
Competence regulation

Genomic Context

Location: 1675300..1685455
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EL078_RS08365 (NCTC8140_01693) comD/comD3 1676040..1677425 (-) 1386 WP_231997656.1 GHKL domain-containing protein Regulator
  EL078_RS08370 (NCTC8140_01694) comD/comD3 1677416..1678807 (-) 1392 WP_231997657.1 GHKL domain-containing protein Regulator
  EL078_RS08375 (NCTC8140_01695) - 1678808..1679005 (-) 198 WP_126438119.1 hypothetical protein -
  EL078_RS08380 (NCTC8140_01696) - 1679167..1679460 (-) 294 WP_024344358.1 bacteriocin immunity protein -
  EL078_RS08385 (NCTC8140_01697) - 1679491..1679796 (-) 306 WP_033153382.1 bacteriocin immunity protein -
  EL078_RS08390 (NCTC8140_01698) - 1679816..1680103 (-) 288 WP_164554332.1 DUF3884 family protein -
  EL078_RS08395 (NCTC8140_01699) comC/comC1 1680300..1680455 (+) 156 WP_126438121.1 competence protein Regulator
  EL078_RS08400 (NCTC8140_01700) comD/comD1 1680476..1681747 (-) 1272 WP_231997658.1 sensor histidine kinase Regulator
  EL078_RS08405 (NCTC8140_01701) comE/comE1 1681806..1682537 (-) 732 WP_074567288.1 response regulator transcription factor Regulator
  EL078_RS09430 (NCTC8140_01704) - 1683400..1683504 (-) 105 WP_231997659.1 bacteriocin class II family protein -
  EL078_RS08410 (NCTC8140_01706) - 1684422..1685033 (-) 612 WP_231997660.1 thioredoxin family protein -

Sequence

Protein


Download         Length: 51 a.a.        Molecular weight: 5716.55 Da        Isoelectric Point: 6.2051

>NTDB_id=1119997 EL078_RS08395 WP_126438121.1 1680300..1680455(+) (comC/comC1) [Streptococcus equinus strain NCTC8140]
MNEWKLSELNSVRNLTEADLEKTVGGDTTLLTGVGIFDWLKNLKNKPQGKI

Nucleotide


Download         Length: 156 bp        

>NTDB_id=1119997 EL078_RS08395 WP_126438121.1 1680300..1680455(+) (comC/comC1) [Streptococcus equinus strain NCTC8140]
ATGAATGAATGGAAATTATCAGAATTAAACTCTGTTAGAAATTTAACAGAAGCTGATTTGGAGAAGACCGTTGGAGGAGA
TACCACTCTACTCACTGGTGTTGGCATTTTTGATTGGTTGAAAAATTTGAAAAATAAGCCACAAGGAAAAATTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comC/comC1 Streptococcus equinus JB1

61.905

82.353

0.51

Multiple sequence alignment