Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   EL098_RS17260 Genome accession   NZ_LR134201
Coordinates   3525259..3525711 (+) Length   150 a.a.
NCBI ID   WP_126357327.1    Uniprot ID   -
Organism   Cedecea lapagei strain NCTC11466     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 3486040..3531838 3525259..3525711 within 0


Gene organization within MGE regions


Location: 3486040..3531838
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EL098_RS16915 - 3486207..3486626 (-) 420 WP_164716887.1 hypothetical protein -
  EL098_RS16920 - 3486628..3487365 (-) 738 WP_126357277.1 hypothetical protein -
  EL098_RS23570 (NCTC11466_03470) - 3487430..3488227 (-) 798 WP_232012233.1 hypothetical protein -
  EL098_RS16930 (NCTC11466_03471) - 3488404..3489051 (-) 648 WP_126357278.1 DUF2612 domain-containing protein -
  EL098_RS16935 (NCTC11466_03472) - 3489048..3490283 (-) 1236 WP_126357279.1 baseplate J/gp47 family protein -
  EL098_RS16940 (NCTC11466_03473) - 3490292..3490651 (-) 360 WP_126357280.1 hypothetical protein -
  EL098_RS16945 (NCTC11466_03474) - 3490923..3491639 (-) 717 WP_126357281.1 Gp138 family membrane-puncturing spike protein -
  EL098_RS16950 (NCTC11466_03475) - 3491614..3492492 (-) 879 WP_126357282.1 hypothetical protein -
  EL098_RS16955 (NCTC11466_03476) - 3492489..3492794 (-) 306 WP_126357283.1 phage baseplate plug protein -
  EL098_RS16960 (NCTC11466_03477) - 3492794..3493600 (-) 807 WP_126357284.1 phage baseplate protein -
  EL098_RS16965 (NCTC11466_03478) - 3493604..3495550 (-) 1947 WP_126357285.1 lytic transglycosylase domain-containing protein -
  EL098_RS16970 (NCTC11466_03479) - 3495595..3496041 (-) 447 WP_126357286.1 hypothetical protein -
  EL098_RS16975 (NCTC11466_03480) - 3496041..3496238 (-) 198 WP_126357287.1 transglycosylase -
  EL098_RS16980 (NCTC11466_03481) - 3496253..3496657 (-) 405 WP_126357288.1 hypothetical protein -
  EL098_RS16985 (NCTC11466_03482) - 3496667..3497110 (-) 444 WP_232012234.1 phage tail fiber protein -
  EL098_RS16990 (NCTC11466_03483) - 3497111..3498589 (-) 1479 WP_126357289.1 DUF3383 domain-containing protein -
  EL098_RS16995 (NCTC11466_03484) - 3498590..3499141 (-) 552 WP_232012235.1 LIC_12616 family protein -
  EL098_RS17000 (NCTC11466_03485) - 3499138..3499506 (-) 369 WP_126357290.1 hypothetical protein -
  EL098_RS17005 (NCTC11466_03486) - 3499506..3499949 (-) 444 WP_126357291.1 hypothetical protein -
  EL098_RS17010 (NCTC11466_03487) - 3499942..3500346 (-) 405 WP_126357292.1 DUF4054 domain-containing protein -
  EL098_RS23575 (NCTC11466_03488) - 3500350..3500676 (-) 327 WP_126357293.1 hypothetical protein -
  EL098_RS17020 (NCTC11466_03489) - 3500676..3501695 (-) 1020 WP_126357294.1 hypothetical protein -
  EL098_RS17025 (NCTC11466_03490) - 3501695..3502021 (-) 327 WP_232012236.1 hypothetical protein -
  EL098_RS17030 (NCTC11466_03491) - 3502194..3503375 (-) 1182 WP_126357296.1 DUF2213 domain-containing protein -
  EL098_RS17035 (NCTC11466_03492) - 3503437..3504246 (-) 810 WP_232012237.1 phage minor head protein -
  EL098_RS17040 (NCTC11466_03493) - 3504203..3505633 (-) 1431 WP_126357297.1 DUF1073 domain-containing protein -
  EL098_RS17045 (NCTC11466_03494) - 3505630..3506999 (-) 1370 Protein_3333 PBSX family phage terminase large subunit -
  EL098_RS17050 (NCTC11466_03495) - 3506986..3507567 (-) 582 WP_126357299.1 terminase small subunit -
  EL098_RS17055 (NCTC11466_03496) - 3507620..3507817 (-) 198 WP_126357300.1 hypothetical protein -
  EL098_RS23240 (NCTC11466_03497) - 3507818..3507985 (-) 168 WP_164716889.1 hypothetical protein -
  EL098_RS17060 (NCTC11466_03498) - 3507988..3508206 (-) 219 WP_126357301.1 hypothetical protein -
  EL098_RS17065 (NCTC11466_03499) - 3508208..3508693 (-) 486 WP_126357302.1 hypothetical protein -
  EL098_RS17075 (NCTC11466_03500) - 3508832..3509245 (-) 414 WP_126357303.1 DUF2570 domain-containing protein -
  EL098_RS17080 (NCTC11466_03501) - 3509242..3509868 (-) 627 WP_126357304.1 glycoside hydrolase family 19 protein -
  EL098_RS23755 - 3509861..3510346 (-) 486 WP_331852860.1 phage holin family protein -
  EL098_RS17095 (NCTC11466_03504) - 3511490..3512251 (-) 762 WP_126357305.1 antitermination protein -
  EL098_RS17100 (NCTC11466_03505) - 3512248..3512454 (-) 207 WP_126357306.1 protein ninH -
  EL098_RS17105 (NCTC11466_03506) - 3512451..3512630 (-) 180 WP_126356128.1 hypothetical protein -
  EL098_RS17110 - 3512627..3512806 (-) 180 WP_126357307.1 hypothetical protein -
  EL098_RS17115 (NCTC11466_03507) rusA 3512803..3513201 (-) 399 WP_126357308.1 crossover junction endodeoxyribonuclease RusA -
  EL098_RS17120 (NCTC11466_03508) - 3513198..3513488 (-) 291 WP_085542934.1 DUF1364 domain-containing protein -
  EL098_RS17125 (NCTC11466_03509) - 3513481..3513780 (-) 300 WP_126356131.1 hypothetical protein -
  EL098_RS23825 (NCTC11466_03510) - 3513773..3513943 (-) 171 WP_126356132.1 protein NinF -
  EL098_RS17135 (NCTC11466_03511) - 3513937..3514716 (-) 780 WP_126356133.1 DNA cytosine methyltransferase -
  EL098_RS17145 (NCTC11466_03513) - 3514921..3515370 (-) 450 WP_126357309.1 DUF1367 family protein -
  EL098_RS17150 (NCTC11466_03514) - 3515374..3515562 (-) 189 WP_126357310.1 hypothetical protein -
  EL098_RS17155 (NCTC11466_03515) - 3515555..3515863 (-) 309 WP_126357311.1 hypothetical protein -
  EL098_RS17160 (NCTC11466_03516) - 3515893..3516114 (-) 222 WP_126357312.1 hypothetical protein -
  EL098_RS23245 (NCTC11466_03517) - 3516104..3516271 (-) 168 WP_164716891.1 hypothetical protein -
  EL098_RS23250 (NCTC11466_03518) - 3516298..3516459 (-) 162 WP_164716893.1 hypothetical protein -
  EL098_RS17165 (NCTC11466_03519) - 3516557..3516775 (-) 219 WP_126357313.1 hypothetical protein -
  EL098_RS17170 (NCTC11466_03520) - 3516772..3516993 (-) 222 WP_126357314.1 hypothetical protein -
  EL098_RS17175 (NCTC11466_03521) - 3516990..3517265 (-) 276 WP_408609085.1 hypothetical protein -
  EL098_RS17180 (NCTC11466_03522) - 3517246..3517617 (-) 372 WP_126357315.1 MarR family transcriptional regulator -
  EL098_RS17185 (NCTC11466_03523) - 3517630..3518394 (-) 765 WP_126357316.1 replication protein P -
  EL098_RS23585 (NCTC11466_03524) - 3518391..3519146 (-) 756 WP_232012238.1 hypothetical protein -
  EL098_RS17195 (NCTC11466_03525) - 3519146..3519817 (-) 672 WP_232012239.1 phage antirepressor KilAC domain-containing protein -
  EL098_RS17200 (NCTC11466_03526) - 3519829..3520125 (-) 297 WP_126357317.1 CII family transcriptional regulator -
  EL098_RS17205 (NCTC11466_03527) - 3520242..3520457 (-) 216 WP_126357318.1 helix-turn-helix domain-containing protein -
  EL098_RS17210 (NCTC11466_03528) - 3520559..3521191 (+) 633 WP_126357319.1 LexA family transcriptional regulator -
  EL098_RS23590 (NCTC11466_03529) - 3521603..3521872 (+) 270 WP_126357320.1 hypothetical protein -
  EL098_RS17220 (NCTC11466_03530) - 3521891..3522118 (+) 228 WP_126357321.1 hypothetical protein -
  EL098_RS17225 (NCTC11466_03531) - 3522223..3522504 (+) 282 WP_126357322.1 hypothetical protein -
  EL098_RS17230 (NCTC11466_03532) - 3522554..3522748 (+) 195 WP_126357323.1 hypothetical protein -
  EL098_RS23830 (NCTC11466_03533) - 3522783..3523040 (+) 258 WP_126357324.1 DUF551 domain-containing protein -
  EL098_RS17240 (NCTC11466_03534) - 3523138..3524112 (+) 975 WP_126357325.1 hypothetical protein -
  EL098_RS17245 (NCTC11466_03535) - 3524196..3524333 (+) 138 WP_126356156.1 protease FtsH-inhibitory lysogeny factor CIII -
  EL098_RS17250 (NCTC11466_03536) - 3524336..3524524 (+) 189 WP_126356157.1 DUF5444 family protein -
  EL098_RS23255 (NCTC11466_03537) - 3524514..3524657 (+) 144 WP_164716895.1 hypothetical protein -
  EL098_RS17255 (NCTC11466_03538) - 3524654..3525259 (+) 606 WP_126357326.1 ERF family protein -
  EL098_RS17260 (NCTC11466_03539) ssb 3525259..3525711 (+) 453 WP_126357327.1 single-stranded DNA-binding protein Machinery gene
  EL098_RS17265 (NCTC11466_03540) - 3525720..3526268 (+) 549 WP_126357328.1 3'-5' exonuclease -
  EL098_RS17270 (NCTC11466_03541) - 3526288..3526593 (+) 306 WP_126357329.1 phage anti-RecBCD protein -
  EL098_RS17275 (NCTC11466_03542) - 3526604..3526864 (+) 261 WP_126357330.1 hypothetical protein -
  EL098_RS17280 - 3526882..3527058 (+) 177 WP_126357331.1 DUF2737 family protein -
  EL098_RS23595 (NCTC11466_03545) - 3527376..3528050 (+) 675 WP_232012240.1 DUF4752 domain-containing protein -
  EL098_RS17290 (NCTC11466_03546) - 3528047..3528532 (+) 486 WP_126356164.1 hypothetical protein -
  EL098_RS17295 (NCTC11466_03547) - 3528529..3529149 (+) 621 WP_126357332.1 hypothetical protein -
  EL098_RS17300 (NCTC11466_03548) - 3529149..3529406 (+) 258 WP_126357333.1 eaa protein -
  EL098_RS17305 (NCTC11466_03549) - 3529399..3529830 (+) 432 WP_126357334.1 hypothetical protein -
  EL098_RS17310 (NCTC11466_03550) - 3529900..3530445 (+) 546 WP_126357335.1 hypothetical protein -
  EL098_RS17315 (NCTC11466_03552) - 3530792..3531838 (+) 1047 WP_126357336.1 site-specific integrase -

Sequence


Protein


Download         Length: 150 a.a.        Molecular weight: 16606.62 Da        Isoelectric Point: 7.2030

>NTDB_id=1118925 EL098_RS17260 WP_126357327.1 3525259..3525711(+) (ssb) [Cedecea lapagei strain NCTC11466]
MANRGVNKVIIVGNLGQDPEVRYLPNGGAVANITLATSESWRDKQTGETKEKTEWHRVVLFGKLAEVAGEYLRKGSQVYI
EGKLTARKWTDQAGVEKYTTEIHVNVGGTMQMLGGKQEGSQQSKPQKKQQQSSQAPSNEPPMDFDDDIPF

Nucleotide


Download         Length: 453 bp        

>NTDB_id=1118925 EL098_RS17260 WP_126357327.1 3525259..3525711(+) (ssb) [Cedecea lapagei strain NCTC11466]
ATGGCTAATCGCGGAGTAAACAAAGTAATCATCGTCGGAAACCTAGGGCAAGACCCCGAGGTTCGTTACCTTCCGAATGG
TGGCGCAGTAGCAAATATCACCCTGGCAACATCCGAGTCATGGCGAGATAAGCAGACTGGCGAGACGAAAGAGAAAACAG
AGTGGCACCGTGTGGTGCTGTTCGGGAAGTTGGCAGAGGTGGCCGGGGAATACCTGCGGAAAGGCTCTCAGGTTTATATC
GAAGGTAAGCTAACGGCTCGAAAATGGACTGACCAGGCAGGAGTGGAAAAGTACACCACAGAGATTCACGTCAATGTCGG
TGGAACCATGCAAATGCTTGGCGGGAAGCAGGAAGGAAGTCAGCAAAGTAAACCTCAGAAAAAACAGCAGCAATCATCAC
AAGCCCCGTCAAATGAACCGCCGATGGATTTCGACGACGACATTCCATTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Vibrio cholerae strain A1552

62.147

100

0.733

  ssb Glaesserella parasuis strain SC1401

50.543

100

0.62

  ssb Neisseria meningitidis MC58

41.477

100

0.487

  ssb Neisseria gonorrhoeae MS11

41.477

100

0.487


Multiple sequence alignment