Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | EW033_RS01880 | Genome accession | NZ_LR130515 |
| Coordinates | 389403..389873 (+) | Length | 156 a.a. |
| NCBI ID | WP_000934759.1 | Uniprot ID | A0A2I7Y8V1 |
| Organism | Staphylococcus aureus strain BPH2947 isolate BPH2947 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 378817..421314 | 389403..389873 | within | 0 |
Gene organization within MGE regions
Location: 378817..421314
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EW033_RS01795 | - | 378817..380022 (-) | 1206 | WP_000264186.1 | tyrosine-type recombinase/integrase | - |
| EW033_RS01800 | - | 380133..380312 (+) | 180 | WP_000337826.1 | hypothetical protein | - |
| EW033_RS01805 | - | 380292..381224 (-) | 933 | WP_000392181.1 | hypothetical protein | - |
| EW033_RS01810 | - | 381256..381981 (-) | 726 | WP_000661437.1 | PH domain-containing protein | - |
| EW033_RS01815 | - | 382009..382683 (-) | 675 | WP_000775187.1 | ImmA/IrrE family metallo-endopeptidase | - |
| EW033_RS01820 | - | 382700..383032 (-) | 333 | WP_001055143.1 | helix-turn-helix domain-containing protein | - |
| EW033_RS01825 | - | 383296..383490 (+) | 195 | WP_000108122.1 | helix-turn-helix domain-containing protein | - |
| EW033_RS01830 | - | 383490..384257 (+) | 768 | WP_001002757.1 | phage antirepressor Ant | - |
| EW033_RS01835 | tscA | 384258..384482 (+) | 225 | WP_000187184.1 | type II toxin-antitoxin system antitoxin TscA | - |
| EW033_RS16480 | - | 384522..384621 (+) | 100 | Protein_349 | hypothetical protein | - |
| EW033_RS01845 | - | 384770..385033 (+) | 264 | WP_001124198.1 | helix-turn-helix domain-containing protein | - |
| EW033_RS01850 | - | 385045..385206 (+) | 162 | WP_000066021.1 | DUF1270 family protein | - |
| EW033_RS01855 | - | 385298..385558 (+) | 261 | WP_000291089.1 | DUF1108 family protein | - |
| EW033_RS01860 | - | 385567..385830 (+) | 264 | WP_001205732.1 | hypothetical protein | - |
| EW033_RS01865 | - | 385839..387782 (+) | 1944 | WP_000700555.1 | AAA family ATPase | - |
| EW033_RS01870 | - | 387784..388704 (+) | 921 | WP_000180598.1 | recombinase RecT | - |
| EW033_RS01875 | - | 388785..389402 (+) | 618 | WP_064135358.1 | MBL fold metallo-hydrolase | - |
| EW033_RS01880 | ssbA | 389403..389873 (+) | 471 | WP_000934759.1 | single-stranded DNA-binding protein | Machinery gene |
| EW033_RS01885 | - | 389903..390796 (+) | 894 | WP_000148333.1 | DnaD domain protein | - |
| EW033_RS01890 | - | 390803..391021 (+) | 219 | WP_000338528.1 | hypothetical protein | - |
| EW033_RS01895 | - | 391030..391434 (+) | 405 | WP_000401969.1 | RusA family crossover junction endodeoxyribonuclease | - |
| EW033_RS01900 | - | 391447..391819 (+) | 373 | Protein_361 | SA1788 family PVL leukocidin-associated protein | - |
| EW033_RS01905 | - | 391819..392076 (+) | 258 | WP_000111491.1 | DUF3310 domain-containing protein | - |
| EW033_RS01910 | - | 392079..392321 (+) | 243 | WP_000221871.1 | SAV1978 family virulence-associated passenger protein | - |
| EW033_RS01915 | - | 392334..392735 (+) | 402 | WP_000695762.1 | hypothetical protein | - |
| EW033_RS01920 | - | 392732..393079 (+) | 348 | WP_000979209.1 | YopX family protein | - |
| EW033_RS01925 | - | 393076..393384 (+) | 309 | WP_000144710.1 | hypothetical protein | - |
| EW033_RS01930 | - | 393377..393625 (+) | 249 | WP_001065026.1 | DUF1024 family protein | - |
| EW033_RS01935 | - | 393618..394154 (+) | 537 | WP_000185663.1 | dUTPase | - |
| EW033_RS01940 | - | 394191..394391 (+) | 201 | WP_000195821.1 | DUF1381 domain-containing protein | - |
| EW033_RS01945 | - | 394490..394726 (+) | 237 | WP_000608279.1 | DUF7366 family protein | - |
| EW033_RS01950 | rinB | 394719..394892 (+) | 174 | WP_000591891.1 | transcriptional activator RinB | - |
| EW033_RS01955 | - | 394893..395258 (+) | 366 | WP_000989954.1 | hypothetical protein | - |
| EW033_RS01960 | - | 395259..395405 (+) | 147 | WP_000989960.1 | hypothetical protein | - |
| EW033_RS01965 | - | 395429..395869 (+) | 441 | WP_000162703.1 | RinA family phage transcriptional activator | - |
| EW033_RS01970 | - | 396180..396674 (+) | 495 | WP_000594082.1 | terminase small subunit | - |
| EW033_RS01975 | - | 396667..397875 (+) | 1209 | WP_001606760.1 | PBSX family phage terminase large subunit | - |
| EW033_RS01980 | - | 397889..399307 (+) | 1419 | WP_000283553.1 | phage portal protein | - |
| EW033_RS01985 | - | 399246..400229 (+) | 984 | WP_014532414.1 | phage head morphogenesis protein | - |
| EW033_RS01990 | - | 400231..400437 (+) | 207 | WP_000346033.1 | hypothetical protein | - |
| EW033_RS01995 | - | 400542..401138 (+) | 597 | WP_000366932.1 | phage scaffolding protein | - |
| EW033_RS02000 | - | 401159..401983 (+) | 825 | WP_001135558.1 | N4-gp56 family major capsid protein | - |
| EW033_RS02005 | - | 402000..402326 (+) | 327 | WP_000278799.1 | Rho termination factor N-terminal domain-containing protein | - |
| EW033_RS02010 | - | 402326..402640 (+) | 315 | WP_000338935.1 | phage head-tail connector protein | - |
| EW033_RS02015 | - | 402633..402968 (+) | 336 | WP_017431444.1 | phage head closure protein | - |
| EW033_RS02020 | - | 402955..403368 (+) | 414 | WP_001151335.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| EW033_RS02025 | - | 403381..403818 (+) | 438 | WP_000270196.1 | DUF3168 domain-containing protein | - |
| EW033_RS02030 | - | 403805..404365 (+) | 561 | WP_000046067.1 | hypothetical protein | - |
| EW033_RS02035 | - | 404427..404921 (+) | 495 | WP_000141082.1 | tail assembly chaperone | - |
| EW033_RS02040 | - | 404942..405283 (+) | 342 | WP_001580347.1 | hypothetical protein | - |
| EW033_RS02045 | - | 405286..408255 (+) | 2970 | WP_000414234.1 | phage tail protein | - |
| EW033_RS02050 | - | 408270..409205 (+) | 936 | WP_000560193.1 | phage tail domain-containing protein | - |
| EW033_RS02055 | - | 409216..411099 (+) | 1884 | WP_001144702.1 | SGNH/GDSL hydrolase family protein | - |
| EW033_RS02060 | - | 411112..413010 (+) | 1899 | WP_000323252.1 | hypothetical protein | - |
| EW033_RS02065 | - | 413010..414833 (+) | 1824 | WP_000259636.1 | phage baseplate upper protein | - |
| EW033_RS02070 | - | 414833..415210 (+) | 378 | WP_000869363.1 | DUF2977 domain-containing protein | - |
| EW033_RS02075 | - | 415220..415393 (+) | 174 | WP_015990323.1 | XkdX family protein | - |
| EW033_RS02080 | - | 415434..415733 (+) | 300 | WP_000466769.1 | DUF2951 domain-containing protein | - |
| EW033_RS02085 | - | 415870..417744 (+) | 1875 | WP_000524040.1 | glucosaminidase domain-containing protein | - |
| EW033_RS02090 | - | 417757..418995 (+) | 1239 | WP_000276640.1 | BppU family phage baseplate upper protein | - |
| EW033_RS02095 | - | 419000..419395 (+) | 396 | WP_000387945.1 | hypothetical protein | - |
| EW033_RS02100 | - | 419451..419888 (+) | 438 | WP_000354132.1 | phage holin | - |
| EW033_RS02105 | - | 419869..421314 (+) | 1446 | WP_129760456.1 | SH3 domain-containing protein | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17641.52 Da Isoelectric Point: 5.2672
>NTDB_id=1116888 EW033_RS01880 WP_000934759.1 389403..389873(+) (ssbA) [Staphylococcus aureus strain BPH2947 isolate BPH2947]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDNDLPF
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDNDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=1116888 EW033_RS01880 WP_000934759.1 389403..389873(+) (ssbA) [Staphylococcus aureus strain BPH2947 isolate BPH2947]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.932 |
100 |
0.635 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50.588 |
100 |
0.551 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
32.203 |
100 |
0.365 |