Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | E0E10_RS11295 | Genome accession | NZ_LR027878 |
| Coordinates | 2147010..2147480 (-) | Length | 156 a.a. |
| NCBI ID | WP_000934759.1 | Uniprot ID | A0A2I7Y8V1 |
| Organism | Staphylococcus aureus strain BPH2003 isolate BPH2003 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2116303..2173511 | 2147010..2147480 | within | 0 |
Gene organization within MGE regions
Location: 2116303..2173511
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| E0E10_RS11070 | scn | 2116303..2116653 (-) | 351 | WP_000702262.1 | complement inhibitor SCIN-A | - |
| E0E10_RS11075 | - | 2117163..2117501 (-) | 339 | Protein_2041 | SH3 domain-containing protein | - |
| E0E10_RS11090 | sak | 2118150..2118641 (-) | 492 | WP_000920041.1 | staphylokinase | - |
| E0E10_RS11095 | - | 2118832..2119587 (-) | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| E0E10_RS11100 | - | 2119599..2119853 (-) | 255 | WP_000611512.1 | phage holin | - |
| E0E10_RS11105 | - | 2119905..2120012 (+) | 108 | Protein_2045 | hypothetical protein | - |
| E0E10_RS11110 | pepG1 | 2120065..2120199 (-) | 135 | WP_000226106.1 | type I toxin-antitoxin system toxin PepG1 | - |
| E0E10_RS11115 | sea | 2120350..2121123 (-) | 774 | WP_000750412.1 | staphylococcal enterotoxin type A | - |
| E0E10_RS11120 | - | 2121496..2121870 (-) | 375 | WP_000340977.1 | hypothetical protein | - |
| E0E10_RS11125 | - | 2121926..2122213 (-) | 288 | WP_001262621.1 | hypothetical protein | - |
| E0E10_RS11130 | - | 2122259..2122411 (-) | 153 | WP_001000059.1 | hypothetical protein | - |
| E0E10_RS11135 | - | 2122404..2126186 (-) | 3783 | WP_000582173.1 | phage tail spike protein | - |
| E0E10_RS11140 | - | 2126202..2127686 (-) | 1485 | WP_000567408.1 | phage distal tail protein | - |
| E0E10_RS11145 | - | 2127683..2132212 (-) | 4530 | WP_001795393.1 | phage tail tape measure protein | - |
| E0E10_RS16660 | gpGT | 2132269..2132406 (-) | 138 | WP_001549167.1 | phage tail assembly chaperone GT | - |
| E0E10_RS11150 | gpG | 2132457..2132807 (-) | 351 | WP_001096355.1 | phage tail assembly chaperone G | - |
| E0E10_RS11155 | - | 2132857..2133081 (-) | 225 | WP_072050172.1 | Ig-like domain-containing protein | - |
| E0E10_RS11160 | - | 2133123..2133767 (-) | 645 | WP_000268741.1 | major tail protein | - |
| E0E10_RS11165 | - | 2133768..2134175 (-) | 408 | WP_000565498.1 | hypothetical protein | - |
| E0E10_RS11170 | - | 2134172..2134576 (-) | 405 | WP_000114225.1 | HK97 gp10 family phage protein | - |
| E0E10_RS11175 | - | 2134573..2134935 (-) | 363 | WP_000755150.1 | head-tail adaptor protein | - |
| E0E10_RS11180 | - | 2134919..2135203 (-) | 285 | WP_000150936.1 | phage head-tail adapter protein | - |
| E0E10_RS11185 | - | 2135193..2135477 (-) | 285 | WP_000238236.1 | hypothetical protein | - |
| E0E10_RS11190 | - | 2135497..2136642 (-) | 1146 | WP_129760512.1 | phage major capsid protein | - |
| E0E10_RS11195 | - | 2136666..2137403 (-) | 738 | WP_000861914.1 | head maturation protease, ClpP-related | - |
| E0E10_RS11200 | - | 2137387..2138574 (-) | 1188 | WP_000025274.1 | phage portal protein | - |
| E0E10_RS11205 | - | 2138590..2140251 (-) | 1662 | WP_000625088.1 | terminase large subunit | - |
| E0E10_RS11210 | - | 2140248..2140592 (-) | 345 | WP_000402904.1 | hypothetical protein | - |
| E0E10_RS11215 | - | 2140723..2141022 (-) | 300 | WP_000988336.1 | HNH endonuclease | - |
| E0E10_RS11220 | - | 2141254..2141670 (-) | 417 | WP_000590126.1 | hypothetical protein | - |
| E0E10_RS11225 | - | 2141698..2141898 (-) | 201 | WP_000265039.1 | DUF1514 family protein | - |
| E0E10_RS16570 | rinB | 2141898..2142044 (-) | 147 | WP_269472074.1 | transcriptional activator RinB | - |
| E0E10_RS11235 | - | 2142110..2142316 (-) | 207 | WP_000195820.1 | DUF1381 domain-containing protein | - |
| E0E10_RS11240 | - | 2142353..2142889 (-) | 537 | WP_001066444.1 | dUTPase | - |
| E0E10_RS11245 | - | 2142882..2143292 (-) | 411 | WP_000197967.1 | hypothetical protein | - |
| E0E10_RS16575 | - | 2143649..2143774 (-) | 126 | Protein_2075 | DUF1024 family protein | - |
| E0E10_RS11255 | - | 2143767..2144051 (-) | 285 | WP_001105604.1 | hypothetical protein | - |
| E0E10_RS11260 | - | 2144048..2144497 (-) | 450 | WP_000982711.1 | YopX family protein | - |
| E0E10_RS11265 | - | 2144562..2144804 (-) | 243 | WP_000221871.1 | SAV1978 family virulence-associated passenger protein | - |
| E0E10_RS11270 | - | 2144807..2145064 (-) | 258 | WP_000111491.1 | DUF3310 domain-containing protein | - |
| E0E10_RS11275 | - | 2145064..2145436 (-) | 373 | Protein_2080 | SA1788 family PVL leukocidin-associated protein | - |
| E0E10_RS11280 | - | 2145449..2145853 (-) | 405 | WP_000401969.1 | RusA family crossover junction endodeoxyribonuclease | - |
| E0E10_RS11285 | - | 2145862..2146080 (-) | 219 | WP_000338528.1 | hypothetical protein | - |
| E0E10_RS11290 | - | 2146087..2146980 (-) | 894 | WP_000148333.1 | DnaD domain protein | - |
| E0E10_RS11295 | ssbA | 2147010..2147480 (-) | 471 | WP_000934759.1 | single-stranded DNA-binding protein | Machinery gene |
| E0E10_RS11300 | - | 2147481..2148098 (-) | 618 | WP_064135358.1 | MBL fold metallo-hydrolase | - |
| E0E10_RS11305 | - | 2148179..2149099 (-) | 921 | WP_000180598.1 | recombinase RecT | - |
| E0E10_RS11310 | - | 2149101..2151044 (-) | 1944 | WP_000700555.1 | AAA family ATPase | - |
| E0E10_RS11315 | - | 2151053..2151316 (-) | 264 | WP_001205732.1 | hypothetical protein | - |
| E0E10_RS11320 | - | 2151325..2151585 (-) | 261 | WP_001814567.1 | DUF1108 family protein | - |
| E0E10_RS11325 | - | 2151566..2151895 (-) | 330 | WP_000138304.1 | hypothetical protein | - |
| E0E10_RS11330 | - | 2151985..2152146 (-) | 162 | WP_000066017.1 | DUF1270 domain-containing protein | - |
| E0E10_RS11335 | - | 2152143..2152463 (-) | 321 | WP_001120197.1 | DUF771 domain-containing protein | - |
| E0E10_RS11340 | - | 2152522..2153154 (+) | 633 | WP_000275058.1 | hypothetical protein | - |
| E0E10_RS11345 | - | 2153169..2153309 (-) | 141 | WP_000939496.1 | hypothetical protein | - |
| E0E10_RS11350 | - | 2153340..2153537 (-) | 198 | WP_001148861.1 | hypothetical protein | - |
| E0E10_RS11355 | - | 2153553..2154302 (-) | 750 | WP_001148653.1 | phage antirepressor KilAC domain-containing protein | - |
| E0E10_RS11360 | - | 2154353..2154682 (+) | 330 | WP_000180411.1 | hypothetical protein | - |
| E0E10_RS11365 | - | 2154671..2154886 (-) | 216 | WP_001025404.1 | Thoeris anti-defense Tad2 family protein | - |
| E0E10_RS11370 | - | 2154902..2155165 (-) | 264 | WP_000854072.1 | helix-turn-helix transcriptional regulator | - |
| E0E10_RS11375 | - | 2155162..2155335 (-) | 174 | WP_001801500.1 | hypothetical protein | - |
| E0E10_RS11380 | - | 2155298..2156011 (+) | 714 | WP_001031454.1 | XRE family transcriptional regulator | - |
| E0E10_RS11385 | - | 2156027..2156959 (+) | 933 | WP_000759682.1 | exonuclease domain-containing protein | - |
| E0E10_RS11390 | - | 2156965..2157306 (+) | 342 | WP_000591749.1 | hypothetical protein | - |
| E0E10_RS11395 | - | 2157510..2157692 (+) | 183 | WP_000705248.1 | hypothetical protein | - |
| E0E10_RS11400 | - | 2157792..2158256 (+) | 465 | WP_000825947.1 | hypothetical protein | - |
| E0E10_RS11405 | - | 2158315..2159352 (+) | 1038 | WP_000857191.1 | tyrosine-type recombinase/integrase | - |
| E0E10_RS11410 | sph | 2159409..2160233 (+) | 825 | Protein_2107 | sphingomyelin phosphodiesterase | - |
| E0E10_RS11415 | lukG | 2160471..2161487 (-) | 1017 | WP_000595324.1 | bi-component leukocidin LukGH subunit G | - |
| E0E10_RS11420 | lukH | 2161509..2162564 (-) | 1056 | WP_000791407.1 | bi-component leukocidin LukGH subunit H | - |
| E0E10_RS11425 | - | 2162999..2164222 (+) | 1224 | WP_000206638.1 | ArgE/DapE family deacylase | - |
| E0E10_RS11430 | - | 2164594..2165437 (-) | 844 | Protein_2111 | class I SAM-dependent methyltransferase | - |
| E0E10_RS11435 | - | 2165499..2166410 (-) | 912 | WP_000825510.1 | iron-hydroxamate ABC transporter substrate-binding protein | - |
| E0E10_RS11440 | - | 2166571..2167878 (+) | 1308 | WP_001045079.1 | TrkH family potassium uptake protein | - |
| E0E10_RS11450 | - | 2168731..2169174 (-) | 444 | WP_000022887.1 | GNAT family N-acetyltransferase | - |
| E0E10_RS11455 | - | 2169280..2169716 (-) | 437 | Protein_2115 | hypothetical protein | - |
| E0E10_RS11460 | - | 2170034..2170624 (-) | 591 | WP_001293058.1 | terminase small subunit | - |
| E0E10_RS11465 | - | 2170621..2170833 (-) | 213 | WP_000128898.1 | LuxR C-terminal-related transcriptional regulator | - |
| E0E10_RS11470 | - | 2170894..2171440 (+) | 547 | Protein_2118 | site-specific integrase | - |
| E0E10_RS11475 | groL | 2171535..2173151 (-) | 1617 | WP_000240653.1 | chaperonin GroEL | - |
| E0E10_RS11480 | groES | 2173227..2173511 (-) | 285 | WP_000917288.1 | co-chaperone GroES | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17641.52 Da Isoelectric Point: 5.2672
>NTDB_id=1116061 E0E10_RS11295 WP_000934759.1 2147010..2147480(-) (ssbA) [Staphylococcus aureus strain BPH2003 isolate BPH2003]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDNDLPF
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDNDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=1116061 E0E10_RS11295 WP_000934759.1 2147010..2147480(-) (ssbA) [Staphylococcus aureus strain BPH2003 isolate BPH2003]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.932 |
100 |
0.635 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50.588 |
100 |
0.551 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
32.203 |
100 |
0.365 |