Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   AT694_RS10370 Genome accession   NZ_LN831036
Coordinates   2052218..2052688 (-) Length   156 a.a.
NCBI ID   WP_000934769.1    Uniprot ID   -
Organism   Staphylococcus aureus strain NCTC13435     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2022723..2074416 2052218..2052688 within 0


Gene organization within MGE regions


Location: 2022723..2074416
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AT694_RS10160 (ERS445051_01916) scn 2022723..2023073 (-) 351 WP_000702263.1 complement inhibitor SCIN-A -
  AT694_RS10165 (ERS445051_01918) - 2023584..2023922 (-) 339 Protein_1923 SH3 domain-containing protein -
  AT694_RS10170 (ERS445051_01919) sak 2024570..2025061 (-) 492 WP_000920038.1 staphylokinase -
  AT694_RS10175 (ERS445051_01920) - 2025252..2026007 (-) 756 WP_000861038.1 CHAP domain-containing protein -
  AT694_RS10180 (ERS445051_01921) - 2026019..2026273 (-) 255 WP_000611512.1 phage holin -
  AT694_RS10185 - 2026325..2026432 (+) 108 WP_001791821.1 hypothetical protein -
  AT694_RS14680 pepG1 2026485..2026619 (-) 135 WP_000880502.1 type I toxin-antitoxin system toxin PepG1 -
  AT694_RS10190 (ERS445051_01923) - 2026804..2027178 (-) 375 WP_000340977.1 hypothetical protein -
  AT694_RS10195 (ERS445051_01924) - 2027234..2027521 (-) 288 WP_001262620.1 hypothetical protein -
  AT694_RS10200 (ERS445051_01925) - 2027567..2027719 (-) 153 WP_001000058.1 hypothetical protein -
  AT694_RS10205 (ERS445051_01926) - 2027712..2031494 (-) 3783 Protein_1932 phage tail spike protein -
  AT694_RS10210 (ERS445051_01927) - 2031510..2033000 (-) 1491 WP_001154317.1 phage distal tail protein -
  AT694_RS10215 (ERS445051_01928) - 2033000..2037682 (-) 4683 WP_001133535.1 phage tail tape measure protein -
  AT694_RS10220 gpGT 2037738..2037860 (-) 123 WP_000571956.1 phage tail assembly chaperone GT -
  AT694_RS10225 (ERS445051_01929) gpG 2037920..2038366 (-) 447 WP_000442601.1 phage tail assembly chaperone G -
  AT694_RS10230 (ERS445051_01930) - 2038431..2039384 (-) 954 WP_000570652.1 major tail protein -
  AT694_RS10235 (ERS445051_01931) - 2039385..2039765 (-) 381 WP_000611449.1 hypothetical protein -
  AT694_RS10240 (ERS445051_01932) - 2039762..2040139 (-) 378 WP_000501244.1 HK97-gp10 family putative phage morphogenesis protein -
  AT694_RS10245 (ERS445051_01933) - 2040139..2040474 (-) 336 WP_000975314.1 head-tail adaptor protein -
  AT694_RS10250 (ERS445051_01934) - 2040461..2040793 (-) 333 WP_001177489.1 head-tail connector protein -
  AT694_RS10255 (ERS445051_01935) - 2040802..2040960 (-) 159 WP_001252099.1 hypothetical protein -
  AT694_RS10260 (ERS445051_01936) - 2040996..2042243 (-) 1248 WP_000849958.1 phage major capsid protein -
  AT694_RS10265 (ERS445051_01937) - 2042331..2042915 (-) 585 WP_000032523.1 HK97 family phage prohead protease -
  AT694_RS10270 (ERS445051_01938) - 2042908..2044158 (-) 1251 WP_000511062.1 phage portal protein -
  AT694_RS10275 (ERS445051_01939) - 2044164..2044364 (-) 201 WP_000365301.1 hypothetical protein -
  AT694_RS10280 (ERS445051_01940) - 2044378..2046072 (-) 1695 WP_000133309.1 terminase large subunit -
  AT694_RS10285 (ERS445051_01941) - 2046072..2046542 (-) 471 WP_000919028.1 phage terminase small subunit P27 family -
  AT694_RS10290 (ERS445051_01942) - 2046671..2047015 (-) 345 WP_016169209.1 HNH endonuclease -
  AT694_RS10295 (ERS445051_01943) - 2047031..2047483 (-) 453 WP_000406193.1 nucleoside triphosphate pyrophosphohydrolase family protein -
  AT694_RS10300 (ERS445051_01944) - 2047597..2048058 (-) 462 WP_000282752.1 hypothetical protein -
  AT694_RS10310 (ERS445051_01945) - 2048081..2048281 (-) 201 WP_001813913.1 DUF1514 family protein -
  AT694_RS10315 (ERS445051_01946) rinB 2048281..2048430 (-) 150 WP_001813911.1 transcriptional activator RinB -
  AT694_RS10320 (ERS445051_01947) - 2048433..2048633 (-) 201 WP_001125015.1 hypothetical protein -
  AT694_RS10325 (ERS445051_01948) - 2048608..2048796 (-) 189 WP_000195782.1 DUF1381 domain-containing protein -
  AT694_RS10330 (ERS445051_01949) - 2048793..2049038 (-) 246 WP_001282074.1 hypothetical protein -
  AT694_RS10335 (ERS445051_01950) - 2049075..2049611 (-) 537 WP_001066447.1 dUTP diphosphatase -
  AT694_RS15110 (ERS445051_01951) - 2049604..2049774 (-) 171 WP_000714403.1 hypothetical protein -
  AT694_RS10340 - 2049761..2050015 (-) 255 Protein_1959 DUF1024 family protein -
  AT694_RS10345 (ERS445051_01953) - 2050030..2050272 (-) 243 WP_000131370.1 SAV1978 family virulence-associated passenger protein -
  AT694_RS10350 (ERS445051_01954) - 2050276..2050644 (-) 369 WP_000101273.1 SA1788 family PVL leukocidin-associated protein -
  AT694_RS10355 (ERS445051_01955) - 2050657..2051061 (-) 405 WP_000401964.1 RusA family crossover junction endodeoxyribonuclease -
  AT694_RS10360 (ERS445051_01956) - 2051070..2051288 (-) 219 WP_000338528.1 hypothetical protein -
  AT694_RS10365 (ERS445051_01957) - 2051295..2052188 (-) 894 WP_000148329.1 DnaD domain-containing protein -
  AT694_RS10370 (ERS445051_01958) ssbA 2052218..2052688 (-) 471 WP_000934769.1 single-stranded DNA-binding protein Machinery gene
  AT694_RS10375 (ERS445051_01959) - 2052689..2053306 (-) 618 WP_071621397.1 MBL fold metallo-hydrolase -
  AT694_RS10380 (ERS445051_01960) - 2053387..2054307 (-) 921 WP_000138481.1 recombinase RecT -
  AT694_RS10385 (ERS445051_01961) - 2054309..2056264 (-) 1956 WP_060540329.1 AAA family ATPase -
  AT694_RS10390 (ERS445051_01962) - 2056261..2056524 (-) 264 WP_001205732.1 hypothetical protein -
  AT694_RS10395 (ERS445051_01963) - 2056533..2056793 (-) 261 WP_000291488.1 DUF1108 family protein -
  AT694_RS10400 (ERS445051_01964) - 2056886..2057047 (-) 162 WP_000066020.1 DUF1270 domain-containing protein -
  AT694_RS10405 (ERS445051_01965) - 2057044..2057364 (-) 321 WP_001120935.1 DUF771 domain-containing protein -
  AT694_RS10410 (ERS445051_01966) - 2057423..2057650 (+) 228 WP_000801108.1 hypothetical protein -
  AT694_RS10415 (ERS445051_01967) - 2057652..2057843 (-) 192 WP_000389906.1 hypothetical protein -
  AT694_RS10420 (ERS445051_01968) - 2057893..2058249 (+) 357 WP_000768245.1 DUF2513 domain-containing protein -
  AT694_RS10425 (ERS445051_01969) - 2058244..2058438 (-) 195 WP_001148859.1 hypothetical protein -
  AT694_RS10430 (ERS445051_01970) - 2058454..2059242 (-) 789 WP_001148565.1 phage antirepressor KilAC domain-containing protein -
  AT694_RS10435 (ERS445051_01971) - 2059258..2059500 (-) 243 WP_000639922.1 DUF739 family protein -
  AT694_RS10440 (ERS445051_01972) - 2059664..2060380 (+) 717 WP_001083967.1 LexA family transcriptional regulator -
  AT694_RS10445 (ERS445051_01973) - 2060392..2061249 (+) 858 WP_000804508.1 HIRAN domain-containing protein -
  AT694_RS10450 (ERS445051_01974) - 2061294..2061476 (+) 183 WP_000705243.1 hypothetical protein -
  AT694_RS10455 (ERS445051_01975) - 2061512..2061658 (+) 147 WP_001013104.1 hypothetical protein -
  AT694_RS10460 (ERS445051_01976) - 2061655..2062269 (-) 615 WP_000191459.1 hypothetical protein -
  AT694_RS10465 (ERS445051_01977) - 2062377..2063414 (+) 1038 WP_000857176.1 site-specific integrase -
  AT694_RS10470 (ERS445051_01978) sph 2063471..2064295 (+) 825 Protein_1985 sphingomyelin phosphodiesterase -
  AT694_RS10475 (ERS445051_01979) lukG 2064796..2065812 (-) 1017 WP_000595401.1 bi-component leukocidin LukGH subunit G -
  AT694_RS10480 (ERS445051_01980) lukH 2065834..2066886 (-) 1053 WP_000791406.1 bi-component leukocidin LukGH subunit H -
  AT694_RS10485 (ERS445051_01981) - 2067322..2068545 (+) 1224 WP_000206636.1 ArgE/DapE family deacylase -
  AT694_RS10490 (ERS445051_01982) - 2069268..2069675 (-) 408 WP_237708945.1 hypothetical protein -
  AT694_RS10495 (ERS445051_01983) - 2070599..2071906 (+) 1308 WP_001045075.1 TrkH family potassium uptake protein -
  AT694_RS10500 (ERS445051_01984) groL 2072440..2074056 (-) 1617 WP_000240642.1 chaperonin GroEL -
  AT694_RS10505 (ERS445051_01985) groES 2074132..2074416 (-) 285 WP_000917289.1 co-chaperone GroES -

Sequence


Protein


Download         Length: 156 a.a.        Molecular weight: 17671.55 Da        Isoelectric Point: 5.2672

>NTDB_id=1114328 AT694_RS10370 WP_000934769.1 2052218..2052688(-) (ssbA) [Staphylococcus aureus strain NCTC13435]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLTGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDNDLPF

Nucleotide


Download         Length: 471 bp        

>NTDB_id=1114328 AT694_RS10370 WP_000934769.1 2052218..2052688(-) (ssbA) [Staphylococcus aureus strain NCTC13435]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGACGGGCGTAGATGGTAGGTTACAAACGCGG
AATTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

55.367

100

0.628

  ssb Latilactobacillus sakei subsp. sakei 23K

50.588

100

0.551

  ssbB Bacillus subtilis subsp. subtilis str. 168

59.434

67.949

0.404

  ssb Glaesserella parasuis strain SC1401

32.203

100

0.365


Multiple sequence alignment