Detailed information
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | AT694_RS10370 | Genome accession | NZ_LN831036 |
| Coordinates | 2052218..2052688 (-) | Length | 156 a.a. |
| NCBI ID | WP_000934769.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain NCTC13435 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2022723..2074416 | 2052218..2052688 | within | 0 |
Gene organization within MGE regions
Location: 2022723..2074416
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AT694_RS10160 (ERS445051_01916) | scn | 2022723..2023073 (-) | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| AT694_RS10165 (ERS445051_01918) | - | 2023584..2023922 (-) | 339 | Protein_1923 | SH3 domain-containing protein | - |
| AT694_RS10170 (ERS445051_01919) | sak | 2024570..2025061 (-) | 492 | WP_000920038.1 | staphylokinase | - |
| AT694_RS10175 (ERS445051_01920) | - | 2025252..2026007 (-) | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| AT694_RS10180 (ERS445051_01921) | - | 2026019..2026273 (-) | 255 | WP_000611512.1 | phage holin | - |
| AT694_RS10185 | - | 2026325..2026432 (+) | 108 | WP_001791821.1 | hypothetical protein | - |
| AT694_RS14680 | pepG1 | 2026485..2026619 (-) | 135 | WP_000880502.1 | type I toxin-antitoxin system toxin PepG1 | - |
| AT694_RS10190 (ERS445051_01923) | - | 2026804..2027178 (-) | 375 | WP_000340977.1 | hypothetical protein | - |
| AT694_RS10195 (ERS445051_01924) | - | 2027234..2027521 (-) | 288 | WP_001262620.1 | hypothetical protein | - |
| AT694_RS10200 (ERS445051_01925) | - | 2027567..2027719 (-) | 153 | WP_001000058.1 | hypothetical protein | - |
| AT694_RS10205 (ERS445051_01926) | - | 2027712..2031494 (-) | 3783 | Protein_1932 | phage tail spike protein | - |
| AT694_RS10210 (ERS445051_01927) | - | 2031510..2033000 (-) | 1491 | WP_001154317.1 | phage distal tail protein | - |
| AT694_RS10215 (ERS445051_01928) | - | 2033000..2037682 (-) | 4683 | WP_001133535.1 | phage tail tape measure protein | - |
| AT694_RS10220 | gpGT | 2037738..2037860 (-) | 123 | WP_000571956.1 | phage tail assembly chaperone GT | - |
| AT694_RS10225 (ERS445051_01929) | gpG | 2037920..2038366 (-) | 447 | WP_000442601.1 | phage tail assembly chaperone G | - |
| AT694_RS10230 (ERS445051_01930) | - | 2038431..2039384 (-) | 954 | WP_000570652.1 | major tail protein | - |
| AT694_RS10235 (ERS445051_01931) | - | 2039385..2039765 (-) | 381 | WP_000611449.1 | hypothetical protein | - |
| AT694_RS10240 (ERS445051_01932) | - | 2039762..2040139 (-) | 378 | WP_000501244.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| AT694_RS10245 (ERS445051_01933) | - | 2040139..2040474 (-) | 336 | WP_000975314.1 | head-tail adaptor protein | - |
| AT694_RS10250 (ERS445051_01934) | - | 2040461..2040793 (-) | 333 | WP_001177489.1 | head-tail connector protein | - |
| AT694_RS10255 (ERS445051_01935) | - | 2040802..2040960 (-) | 159 | WP_001252099.1 | hypothetical protein | - |
| AT694_RS10260 (ERS445051_01936) | - | 2040996..2042243 (-) | 1248 | WP_000849958.1 | phage major capsid protein | - |
| AT694_RS10265 (ERS445051_01937) | - | 2042331..2042915 (-) | 585 | WP_000032523.1 | HK97 family phage prohead protease | - |
| AT694_RS10270 (ERS445051_01938) | - | 2042908..2044158 (-) | 1251 | WP_000511062.1 | phage portal protein | - |
| AT694_RS10275 (ERS445051_01939) | - | 2044164..2044364 (-) | 201 | WP_000365301.1 | hypothetical protein | - |
| AT694_RS10280 (ERS445051_01940) | - | 2044378..2046072 (-) | 1695 | WP_000133309.1 | terminase large subunit | - |
| AT694_RS10285 (ERS445051_01941) | - | 2046072..2046542 (-) | 471 | WP_000919028.1 | phage terminase small subunit P27 family | - |
| AT694_RS10290 (ERS445051_01942) | - | 2046671..2047015 (-) | 345 | WP_016169209.1 | HNH endonuclease | - |
| AT694_RS10295 (ERS445051_01943) | - | 2047031..2047483 (-) | 453 | WP_000406193.1 | nucleoside triphosphate pyrophosphohydrolase family protein | - |
| AT694_RS10300 (ERS445051_01944) | - | 2047597..2048058 (-) | 462 | WP_000282752.1 | hypothetical protein | - |
| AT694_RS10310 (ERS445051_01945) | - | 2048081..2048281 (-) | 201 | WP_001813913.1 | DUF1514 family protein | - |
| AT694_RS10315 (ERS445051_01946) | rinB | 2048281..2048430 (-) | 150 | WP_001813911.1 | transcriptional activator RinB | - |
| AT694_RS10320 (ERS445051_01947) | - | 2048433..2048633 (-) | 201 | WP_001125015.1 | hypothetical protein | - |
| AT694_RS10325 (ERS445051_01948) | - | 2048608..2048796 (-) | 189 | WP_000195782.1 | DUF1381 domain-containing protein | - |
| AT694_RS10330 (ERS445051_01949) | - | 2048793..2049038 (-) | 246 | WP_001282074.1 | hypothetical protein | - |
| AT694_RS10335 (ERS445051_01950) | - | 2049075..2049611 (-) | 537 | WP_001066447.1 | dUTP diphosphatase | - |
| AT694_RS15110 (ERS445051_01951) | - | 2049604..2049774 (-) | 171 | WP_000714403.1 | hypothetical protein | - |
| AT694_RS10340 | - | 2049761..2050015 (-) | 255 | Protein_1959 | DUF1024 family protein | - |
| AT694_RS10345 (ERS445051_01953) | - | 2050030..2050272 (-) | 243 | WP_000131370.1 | SAV1978 family virulence-associated passenger protein | - |
| AT694_RS10350 (ERS445051_01954) | - | 2050276..2050644 (-) | 369 | WP_000101273.1 | SA1788 family PVL leukocidin-associated protein | - |
| AT694_RS10355 (ERS445051_01955) | - | 2050657..2051061 (-) | 405 | WP_000401964.1 | RusA family crossover junction endodeoxyribonuclease | - |
| AT694_RS10360 (ERS445051_01956) | - | 2051070..2051288 (-) | 219 | WP_000338528.1 | hypothetical protein | - |
| AT694_RS10365 (ERS445051_01957) | - | 2051295..2052188 (-) | 894 | WP_000148329.1 | DnaD domain-containing protein | - |
| AT694_RS10370 (ERS445051_01958) | ssbA | 2052218..2052688 (-) | 471 | WP_000934769.1 | single-stranded DNA-binding protein | Machinery gene |
| AT694_RS10375 (ERS445051_01959) | - | 2052689..2053306 (-) | 618 | WP_071621397.1 | MBL fold metallo-hydrolase | - |
| AT694_RS10380 (ERS445051_01960) | - | 2053387..2054307 (-) | 921 | WP_000138481.1 | recombinase RecT | - |
| AT694_RS10385 (ERS445051_01961) | - | 2054309..2056264 (-) | 1956 | WP_060540329.1 | AAA family ATPase | - |
| AT694_RS10390 (ERS445051_01962) | - | 2056261..2056524 (-) | 264 | WP_001205732.1 | hypothetical protein | - |
| AT694_RS10395 (ERS445051_01963) | - | 2056533..2056793 (-) | 261 | WP_000291488.1 | DUF1108 family protein | - |
| AT694_RS10400 (ERS445051_01964) | - | 2056886..2057047 (-) | 162 | WP_000066020.1 | DUF1270 domain-containing protein | - |
| AT694_RS10405 (ERS445051_01965) | - | 2057044..2057364 (-) | 321 | WP_001120935.1 | DUF771 domain-containing protein | - |
| AT694_RS10410 (ERS445051_01966) | - | 2057423..2057650 (+) | 228 | WP_000801108.1 | hypothetical protein | - |
| AT694_RS10415 (ERS445051_01967) | - | 2057652..2057843 (-) | 192 | WP_000389906.1 | hypothetical protein | - |
| AT694_RS10420 (ERS445051_01968) | - | 2057893..2058249 (+) | 357 | WP_000768245.1 | DUF2513 domain-containing protein | - |
| AT694_RS10425 (ERS445051_01969) | - | 2058244..2058438 (-) | 195 | WP_001148859.1 | hypothetical protein | - |
| AT694_RS10430 (ERS445051_01970) | - | 2058454..2059242 (-) | 789 | WP_001148565.1 | phage antirepressor KilAC domain-containing protein | - |
| AT694_RS10435 (ERS445051_01971) | - | 2059258..2059500 (-) | 243 | WP_000639922.1 | DUF739 family protein | - |
| AT694_RS10440 (ERS445051_01972) | - | 2059664..2060380 (+) | 717 | WP_001083967.1 | LexA family transcriptional regulator | - |
| AT694_RS10445 (ERS445051_01973) | - | 2060392..2061249 (+) | 858 | WP_000804508.1 | HIRAN domain-containing protein | - |
| AT694_RS10450 (ERS445051_01974) | - | 2061294..2061476 (+) | 183 | WP_000705243.1 | hypothetical protein | - |
| AT694_RS10455 (ERS445051_01975) | - | 2061512..2061658 (+) | 147 | WP_001013104.1 | hypothetical protein | - |
| AT694_RS10460 (ERS445051_01976) | - | 2061655..2062269 (-) | 615 | WP_000191459.1 | hypothetical protein | - |
| AT694_RS10465 (ERS445051_01977) | - | 2062377..2063414 (+) | 1038 | WP_000857176.1 | site-specific integrase | - |
| AT694_RS10470 (ERS445051_01978) | sph | 2063471..2064295 (+) | 825 | Protein_1985 | sphingomyelin phosphodiesterase | - |
| AT694_RS10475 (ERS445051_01979) | lukG | 2064796..2065812 (-) | 1017 | WP_000595401.1 | bi-component leukocidin LukGH subunit G | - |
| AT694_RS10480 (ERS445051_01980) | lukH | 2065834..2066886 (-) | 1053 | WP_000791406.1 | bi-component leukocidin LukGH subunit H | - |
| AT694_RS10485 (ERS445051_01981) | - | 2067322..2068545 (+) | 1224 | WP_000206636.1 | ArgE/DapE family deacylase | - |
| AT694_RS10490 (ERS445051_01982) | - | 2069268..2069675 (-) | 408 | WP_237708945.1 | hypothetical protein | - |
| AT694_RS10495 (ERS445051_01983) | - | 2070599..2071906 (+) | 1308 | WP_001045075.1 | TrkH family potassium uptake protein | - |
| AT694_RS10500 (ERS445051_01984) | groL | 2072440..2074056 (-) | 1617 | WP_000240642.1 | chaperonin GroEL | - |
| AT694_RS10505 (ERS445051_01985) | groES | 2074132..2074416 (-) | 285 | WP_000917289.1 | co-chaperone GroES | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17671.55 Da Isoelectric Point: 5.2672
>NTDB_id=1114328 AT694_RS10370 WP_000934769.1 2052218..2052688(-) (ssbA) [Staphylococcus aureus strain NCTC13435]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLTGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDNDLPF
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLTGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDNDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=1114328 AT694_RS10370 WP_000934769.1 2052218..2052688(-) (ssbA) [Staphylococcus aureus strain NCTC13435]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGACGGGCGTAGATGGTAGGTTACAAACGCGG
AATTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGACGGGCGTAGATGGTAGGTTACAAACGCGG
AATTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.367 |
100 |
0.628 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50.588 |
100 |
0.551 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
32.203 |
100 |
0.365 |