Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   ACOCI8_RS05970 Genome accession   NZ_CP184563
Coordinates   1225543..1226013 (+) Length   156 a.a.
NCBI ID   WP_096002306.1    Uniprot ID   -
Organism   Staphylococcus aureus strain SCTW2018065     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1202834..1255663 1225543..1226013 within 0


Gene organization within MGE regions


Location: 1202834..1255663
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACOCI8_RS05810 (ACOCI8_05810) groES 1202834..1203118 (+) 285 WP_000917289.1 co-chaperone GroES -
  ACOCI8_RS05815 (ACOCI8_05815) groL 1203194..1204810 (+) 1617 WP_000240642.1 chaperonin GroEL -
  ACOCI8_RS05820 (ACOCI8_05820) - 1205351..1205530 (+) 180 WP_000201398.1 hypothetical protein -
  ACOCI8_RS05825 (ACOCI8_05825) - 1205527..1206153 (+) 627 WP_000216896.1 hypothetical protein -
  ACOCI8_RS05830 (ACOCI8_05830) - 1206692..1207999 (-) 1308 WP_001045074.1 TrkH family potassium uptake protein -
  ACOCI8_RS05835 (ACOCI8_05835) - 1208382..1209605 (-) 1224 WP_000206618.1 ArgE/DapE family deacylase -
  ACOCI8_RS05840 (ACOCI8_05840) - 1210037..1211092 (+) 1056 WP_000791397.1 leukocidin family pore-forming toxin -
  ACOCI8_RS05845 (ACOCI8_05845) - 1211114..1212130 (+) 1017 WP_000595612.1 leukocidin/hemolysin toxin family protein -
  ACOCI8_RS05850 (ACOCI8_05850) sph 1212392..1213218 (-) 827 Protein_1148 sphingomyelin phosphodiesterase -
  ACOCI8_RS05855 (ACOCI8_05855) - 1213275..1214312 (-) 1038 WP_000857200.1 tyrosine-type recombinase/integrase -
  ACOCI8_RS05860 (ACOCI8_05860) - 1214505..1215209 (-) 705 WP_017804779.1 type II toxin-antitoxin system PemK/MazF family toxin -
  ACOCI8_RS05865 (ACOCI8_05865) - 1215349..1215516 (-) 168 WP_000694771.1 hypothetical protein -
  ACOCI8_RS05870 (ACOCI8_05870) - 1215720..1216061 (-) 342 WP_000591749.1 hypothetical protein -
  ACOCI8_RS05875 (ACOCI8_05875) - 1216067..1216999 (-) 933 WP_096002309.1 exonuclease domain-containing protein -
  ACOCI8_RS05880 (ACOCI8_05880) - 1217015..1217728 (-) 714 WP_001031454.1 XRE family transcriptional regulator -
  ACOCI8_RS05885 (ACOCI8_05885) - 1217691..1217865 (+) 175 Protein_1155 transcriptional regulator -
  ACOCI8_RS05890 (ACOCI8_05890) - 1217862..1218125 (+) 264 WP_000854072.1 helix-turn-helix transcriptional regulator -
  ACOCI8_RS05895 (ACOCI8_05895) - 1218141..1218356 (+) 216 WP_001025404.1 Thoeris anti-defense Tad2 family protein -
  ACOCI8_RS05900 (ACOCI8_05900) - 1218345..1218674 (-) 330 WP_000128907.1 hypothetical protein -
  ACOCI8_RS05905 (ACOCI8_05905) - 1218725..1219477 (+) 753 WP_096002308.1 phage antirepressor KilAC domain-containing protein -
  ACOCI8_RS05910 (ACOCI8_05910) - 1219490..1219750 (+) 261 WP_000435343.1 hypothetical protein -
  ACOCI8_RS05915 (ACOCI8_05915) - 1219774..1219929 (-) 156 Protein_1161 hypothetical protein -
  ACOCI8_RS05920 (ACOCI8_05920) - 1219984..1220310 (+) 327 WP_001025595.1 hypothetical protein -
  ACOCI8_RS05925 (ACOCI8_05925) - 1220307..1220406 (+) 100 Protein_1163 hypothetical protein -
  ACOCI8_RS05930 (ACOCI8_05930) - 1220555..1220878 (+) 324 WP_001120201.1 DUF771 domain-containing protein -
  ACOCI8_RS05935 (ACOCI8_05935) - 1220875..1221036 (+) 162 WP_000048129.1 DUF1270 family protein -
  ACOCI8_RS05940 (ACOCI8_05940) - 1221131..1221433 (+) 303 WP_000165371.1 DUF2482 family protein -
  ACOCI8_RS05945 (ACOCI8_05945) - 1221438..1221698 (+) 261 WP_000291510.1 DUF1108 family protein -
  ACOCI8_RS05950 (ACOCI8_05950) - 1221707..1221970 (+) 264 WP_001205732.1 hypothetical protein -
  ACOCI8_RS05955 (ACOCI8_05955) - 1221979..1223922 (+) 1944 WP_096002307.1 AAA family ATPase -
  ACOCI8_RS05960 (ACOCI8_05960) - 1223924..1224844 (+) 921 WP_000138475.1 recombinase RecT -
  ACOCI8_RS05965 (ACOCI8_05965) - 1224925..1225542 (+) 618 WP_078065545.1 MBL fold metallo-hydrolase -
  ACOCI8_RS05970 (ACOCI8_05970) ssbA 1225543..1226013 (+) 471 WP_096002306.1 single-stranded DNA-binding protein Machinery gene
  ACOCI8_RS05975 (ACOCI8_05975) - 1226043..1226894 (+) 852 WP_164097226.1 DnaD domain protein -
  ACOCI8_RS05980 (ACOCI8_05980) - 1226901..1227119 (+) 219 WP_000338530.1 hypothetical protein -
  ACOCI8_RS05985 (ACOCI8_05985) - 1227128..1227531 (+) 404 Protein_1175 RusA family crossover junction endodeoxyribonuclease -
  ACOCI8_RS05990 (ACOCI8_05990) - 1227544..1227912 (+) 369 WP_096002305.1 SA1788 family PVL leukocidin-associated protein -
  ACOCI8_RS05995 (ACOCI8_05995) - 1227916..1228158 (+) 243 WP_096002304.1 phi PVL orf 51-like protein -
  ACOCI8_RS06000 (ACOCI8_06000) - 1228173..1228421 (+) 249 WP_096002303.1 DUF1024 family protein -
  ACOCI8_RS06005 (ACOCI8_06005) - 1228414..1228947 (+) 534 WP_096002302.1 dUTP diphosphatase -
  ACOCI8_RS06010 (ACOCI8_06010) - 1228984..1229229 (+) 246 WP_001282074.1 hypothetical protein -
  ACOCI8_RS06015 (ACOCI8_06015) - 1229226..1229414 (+) 189 WP_000195782.1 DUF1381 domain-containing protein -
  ACOCI8_RS06020 (ACOCI8_06020) - 1229389..1229589 (+) 201 WP_001125015.1 hypothetical protein -
  ACOCI8_RS06025 (ACOCI8_06025) rinB 1229592..1229741 (+) 150 WP_000237868.1 transcriptional activator RinB -
  ACOCI8_RS06030 (ACOCI8_06030) - 1229900..1230550 (+) 651 WP_001005262.1 hypothetical protein -
  ACOCI8_RS06035 (ACOCI8_06035) - 1230550..1230750 (+) 201 WP_000265042.1 DUF1514 family protein -
  ACOCI8_RS06040 (ACOCI8_06040) - 1230778..1231194 (+) 417 WP_000590122.1 hypothetical protein -
  ACOCI8_RS06045 (ACOCI8_06045) - 1231426..1231725 (+) 300 WP_000988332.1 HNH endonuclease -
  ACOCI8_RS06050 (ACOCI8_06050) - 1231856..1232200 (+) 345 WP_000402904.1 hypothetical protein -
  ACOCI8_RS06055 (ACOCI8_06055) - 1232197..1233858 (+) 1662 WP_000625088.1 terminase large subunit -
  ACOCI8_RS06060 (ACOCI8_06060) - 1233874..1235061 (+) 1188 WP_000025274.1 phage portal protein -
  ACOCI8_RS06065 (ACOCI8_06065) - 1235045..1235782 (+) 738 WP_096002301.1 head maturation protease, ClpP-related -
  ACOCI8_RS06070 (ACOCI8_06070) - 1235806..1236951 (+) 1146 WP_000154559.1 phage major capsid protein -
  ACOCI8_RS06075 (ACOCI8_06075) - 1236971..1237254 (+) 284 Protein_1193 hypothetical protein -
  ACOCI8_RS06080 (ACOCI8_06080) - 1237244..1237528 (+) 285 WP_000150936.1 phage head-tail adapter protein -
  ACOCI8_RS06085 (ACOCI8_06085) - 1237512..1237874 (+) 363 WP_000755150.1 head-tail adaptor protein -
  ACOCI8_RS06090 (ACOCI8_06090) - 1237871..1238275 (+) 405 WP_000114226.1 HK97 gp10 family phage protein -
  ACOCI8_RS06095 (ACOCI8_06095) - 1238272..1238679 (+) 408 WP_000565498.1 hypothetical protein -
  ACOCI8_RS06100 (ACOCI8_06100) - 1238680..1239324 (+) 645 WP_000268735.1 major tail protein -
  ACOCI8_RS06105 (ACOCI8_06105) - 1239360..1239590 (+) 231 Protein_1199 Ig-like domain-containing protein -
  ACOCI8_RS06110 (ACOCI8_06110) gpG 1239640..1239990 (+) 351 WP_001096355.1 phage tail assembly chaperone G -
  ACOCI8_RS06115 (ACOCI8_06115) gpGT 1240041..1240178 (+) 138 WP_001549167.1 phage tail assembly chaperone GT -
  ACOCI8_RS06120 (ACOCI8_06120) - 1240235..1244746 (+) 4512 WP_096002300.1 phage tail tape measure protein -
  ACOCI8_RS06125 (ACOCI8_06125) - 1244743..1246227 (+) 1485 WP_000567408.1 phage distal tail protein -
  ACOCI8_RS06130 (ACOCI8_06130) - 1246243..1250028 (+) 3786 WP_096777926.1 phage tail spike protein -
  ACOCI8_RS06135 (ACOCI8_06135) - 1250018..1250170 (+) 153 WP_001153681.1 hypothetical protein -
  ACOCI8_RS06140 (ACOCI8_06140) - 1250217..1250504 (+) 288 WP_001040261.1 hypothetical protein -
  ACOCI8_RS06145 (ACOCI8_06145) - 1250562..1250858 (+) 297 WP_000539688.1 DUF2951 domain-containing protein -
  ACOCI8_RS06150 (ACOCI8_06150) pepG1 1251050..1251184 (+) 135 WP_000226108.1 type I toxin-antitoxin system toxin PepG1 -
  ACOCI8_RS06155 (ACOCI8_06155) - 1251237..1251344 (-) 108 WP_001791821.1 hypothetical protein -
  ACOCI8_RS06160 (ACOCI8_06160) - 1251396..1251650 (+) 255 WP_000611512.1 phage holin -
  ACOCI8_RS06165 (ACOCI8_06165) - 1251662..1252417 (+) 756 WP_000861038.1 CHAP domain-containing protein -
  ACOCI8_RS06170 (ACOCI8_06170) sak 1252608..1253099 (+) 492 WP_000919350.1 staphylokinase -
  ACOCI8_RS06175 (ACOCI8_06175) - 1253746..1254084 (+) 339 Protein_1213 SH3 domain-containing protein -
  ACOCI8_RS06180 (ACOCI8_06180) - 1254179..1254628 (-) 450 WP_000727649.1 chemotaxis-inhibiting protein CHIPS -
  ACOCI8_RS06185 (ACOCI8_06185) scn 1255313..1255663 (+) 351 WP_000702263.1 complement inhibitor SCIN-A -

Sequence


Protein


Download         Length: 156 a.a.        Molecular weight: 17657.52 Da        Isoelectric Point: 5.2672

>NTDB_id=1109573 ACOCI8_RS05970 WP_096002306.1 1225543..1226013(+) (ssbA) [Staphylococcus aureus strain SCTW2018065]
MINRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINVIVFKKQAENVNKYLSKGSLTGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDNDLPF

Nucleotide


Download         Length: 471 bp        

>NTDB_id=1109573 ACOCI8_RS05970 WP_096002306.1 1225543..1226013(+) (ssbA) [Staphylococcus aureus strain SCTW2018065]
ATGATAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGGACCACTCAAAGTGGTGTAAATGTAGC
ATCATTTACATTAGCAGTTAACCGTACATTTACGAATGCACAAGGCGAGCGCGAGGCAGATTTTATTAATGTCATTGTAT
TTAAAAAACAAGCAGAGAATGTAAATAAATACCTATCTAAAGGATCGTTGACGGGCGTAGATGGTAGGTTACAAACGCGG
AATTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

54.802

100

0.622

  ssb Latilactobacillus sakei subsp. sakei 23K

51.176

100

0.558

  ssbB Bacillus subtilis subsp. subtilis str. 168

59.434

67.949

0.404

  ssb Vibrio cholerae strain A1552

31.492

100

0.365


Multiple sequence alignment