Detailed information NTG1107244

Bioinformatically predicted

Overview

• Name: comGD
• Type: Machinery gene
• Locus tag: ACM5XX_RS12180
• Genome accession: NZ_CP183946
• Coordinates: 2493270..2493707 (-)
• Length: 145 a.a.
• NCBI ID: WP_014305413.1
• Uniprot ID: -
• Organism: Bacillus velezensis strain HKSSLJEBR3
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2488270..2498707

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
ACM5XX_RS12130 (ACM5XX_12130)	sinI	2488655..2488828 (+)	174	WP_003153105.1	anti-repressor SinI	Regulator
ACM5XX_RS12135 (ACM5XX_12135)	sinR	2488862..2489197 (+)	336	WP_003153104.1	transcriptional regulator SinR	Regulator
ACM5XX_RS12140 (ACM5XX_12140)	tasA	2489245..2490030 (-)	786	WP_003153102.1	biofilm matrix protein TasA	-
ACM5XX_RS12145 (ACM5XX_12145)	sipW	2490094..2490678 (-)	585	WP_014305408.1	signal peptidase I SipW	-
ACM5XX_RS12150 (ACM5XX_12150)	tapA	2490650..2491321 (-)	672	WP_014305409.1	amyloid fiber anchoring/assembly protein TapA	-
ACM5XX_RS12155 (ACM5XX_12155)	-	2491580..2491909 (+)	330	WP_003153097.1	DUF3889 domain-containing protein	-
ACM5XX_RS12160 (ACM5XX_12160)	-	2491949..2492128 (-)	180	WP_003153093.1	YqzE family protein	-
ACM5XX_RS12165 (ACM5XX_12165)	comGG	2492185..2492562 (-)	378	WP_014305410.1	competence type IV pilus minor pilin ComGG	Machinery gene
ACM5XX_RS12170 (ACM5XX_12170)	comGF	2492563..2493063 (-)	501	WP_014305411.1	competence type IV pilus minor pilin ComGF	-
ACM5XX_RS12175 (ACM5XX_12175)	comGE	2492972..2493286 (-)	315	WP_041481885.1	competence type IV pilus minor pilin ComGE	Machinery gene
ACM5XX_RS12180 (ACM5XX_12180)	comGD	2493270..2493707 (-)	438	WP_014305413.1	competence type IV pilus minor pilin ComGD	Machinery gene
ACM5XX_RS12185 (ACM5XX_12185)	comGC	2493697..2494005 (-)	309	WP_003153087.1	competence type IV pilus major pilin ComGC	Machinery gene
ACM5XX_RS12190 (ACM5XX_12190)	comGB	2494010..2495047 (-)	1038	WP_014305414.1	competence type IV pilus assembly protein ComGB	Machinery gene
ACM5XX_RS12195 (ACM5XX_12195)	comGA	2495034..2496104 (-)	1071	WP_003153083.1	competence type IV pilus ATPase ComGA	Machinery gene
ACM5XX_RS12200 (ACM5XX_12200)	-	2496296..2497246 (-)	951	WP_014305415.1	magnesium transporter CorA family protein	-
ACM5XX_RS12205 (ACM5XX_12205)	-	2497392..2498693 (+)	1302	WP_014305416.1	hemolysin family protein	-

Sequence

Protein

• Length: 145 a.a.
• Molecular weight: 16310.83 Da
• Isoelectric Point: 10.3725

>NTDB_id=1107244 ACM5XX_RS12180 WP_014305413.1 2493270..2493707(-) (comGD) [Bacillus velezensis strain HKSSLJEBR3]
MNNNRRTENGFTLLESLVVLSLASVLLTVLFTTVPPVCTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPREHKYK
LQSAGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIRLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide

• Length: 438 bp

>NTDB_id=1107244 ACM5XX_RS12180 WP_014305413.1 2493270..2493707(-) (comGD) [Bacillus velezensis strain HKSSLJEBR3]
TTGAACAATAACAGGCGGACAGAAAACGGGTTTACCCTTCTTGAAAGCCTGGTTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGTCTGCACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTTCAAAAAGATA
TTCAGCTTGCGCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAGAGAGCATAAATACAAA
CTGCAGTCAGCCGGAAGGATTGTCGAGCGTTCTTTTGATTCGCTTCACATTACACTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATTCGATTGAAGAGCGCCGGGTTCACCTATGAGATCACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (5-31)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGD	Bacillus subtilis subsp. subtilis str. 168	54.795	100	0.552