Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | ACM5XX_RS12130 | Genome accession | NZ_CP183946 |
| Coordinates | 2488655..2488828 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain HKSSLJEBR3 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2483655..2493828
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACM5XX_RS12115 (ACM5XX_12115) | gcvT | 2484473..2485573 (-) | 1101 | WP_014305405.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| ACM5XX_RS12120 (ACM5XX_12120) | - | 2485996..2487666 (+) | 1671 | WP_003153107.1 | DEAD/DEAH box helicase | - |
| ACM5XX_RS12125 (ACM5XX_12125) | - | 2487684..2488478 (+) | 795 | WP_014305407.1 | YqhG family protein | - |
| ACM5XX_RS12130 (ACM5XX_12130) | sinI | 2488655..2488828 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| ACM5XX_RS12135 (ACM5XX_12135) | sinR | 2488862..2489197 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| ACM5XX_RS12140 (ACM5XX_12140) | tasA | 2489245..2490030 (-) | 786 | WP_003153102.1 | biofilm matrix protein TasA | - |
| ACM5XX_RS12145 (ACM5XX_12145) | sipW | 2490094..2490678 (-) | 585 | WP_014305408.1 | signal peptidase I SipW | - |
| ACM5XX_RS12150 (ACM5XX_12150) | tapA | 2490650..2491321 (-) | 672 | WP_014305409.1 | amyloid fiber anchoring/assembly protein TapA | - |
| ACM5XX_RS12155 (ACM5XX_12155) | - | 2491580..2491909 (+) | 330 | WP_003153097.1 | DUF3889 domain-containing protein | - |
| ACM5XX_RS12160 (ACM5XX_12160) | - | 2491949..2492128 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| ACM5XX_RS12165 (ACM5XX_12165) | comGG | 2492185..2492562 (-) | 378 | WP_014305410.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| ACM5XX_RS12170 (ACM5XX_12170) | comGF | 2492563..2493063 (-) | 501 | WP_014305411.1 | competence type IV pilus minor pilin ComGF | - |
| ACM5XX_RS12175 (ACM5XX_12175) | comGE | 2492972..2493286 (-) | 315 | WP_041481885.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| ACM5XX_RS12180 (ACM5XX_12180) | comGD | 2493270..2493707 (-) | 438 | WP_014305413.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=1107240 ACM5XX_RS12130 WP_003153105.1 2488655..2488828(+) (sinI) [Bacillus velezensis strain HKSSLJEBR3]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=1107240 ACM5XX_RS12130 WP_003153105.1 2488655..2488828(+) (sinI) [Bacillus velezensis strain HKSSLJEBR3]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |