Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   ACM5XX_RS12175 Genome accession   NZ_CP183946
Coordinates   2492972..2493286 (-) Length   104 a.a.
NCBI ID   WP_041481885.1    Uniprot ID   -
Organism   Bacillus velezensis strain HKSSLJEBR3     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2487972..2498286
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACM5XX_RS12130 (ACM5XX_12130) sinI 2488655..2488828 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  ACM5XX_RS12135 (ACM5XX_12135) sinR 2488862..2489197 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  ACM5XX_RS12140 (ACM5XX_12140) tasA 2489245..2490030 (-) 786 WP_003153102.1 biofilm matrix protein TasA -
  ACM5XX_RS12145 (ACM5XX_12145) sipW 2490094..2490678 (-) 585 WP_014305408.1 signal peptidase I SipW -
  ACM5XX_RS12150 (ACM5XX_12150) tapA 2490650..2491321 (-) 672 WP_014305409.1 amyloid fiber anchoring/assembly protein TapA -
  ACM5XX_RS12155 (ACM5XX_12155) - 2491580..2491909 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  ACM5XX_RS12160 (ACM5XX_12160) - 2491949..2492128 (-) 180 WP_003153093.1 YqzE family protein -
  ACM5XX_RS12165 (ACM5XX_12165) comGG 2492185..2492562 (-) 378 WP_014305410.1 competence type IV pilus minor pilin ComGG Machinery gene
  ACM5XX_RS12170 (ACM5XX_12170) comGF 2492563..2493063 (-) 501 WP_014305411.1 competence type IV pilus minor pilin ComGF -
  ACM5XX_RS12175 (ACM5XX_12175) comGE 2492972..2493286 (-) 315 WP_041481885.1 competence type IV pilus minor pilin ComGE Machinery gene
  ACM5XX_RS12180 (ACM5XX_12180) comGD 2493270..2493707 (-) 438 WP_014305413.1 competence type IV pilus minor pilin ComGD Machinery gene
  ACM5XX_RS12185 (ACM5XX_12185) comGC 2493697..2494005 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  ACM5XX_RS12190 (ACM5XX_12190) comGB 2494010..2495047 (-) 1038 WP_014305414.1 competence type IV pilus assembly protein ComGB Machinery gene
  ACM5XX_RS12195 (ACM5XX_12195) comGA 2495034..2496104 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  ACM5XX_RS12200 (ACM5XX_12200) - 2496296..2497246 (-) 951 WP_014305415.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 104 a.a.        Molecular weight: 11830.82 Da        Isoelectric Point: 6.9470

>NTDB_id=1107243 ACM5XX_RS12175 WP_041481885.1 2492972..2493286(-) (comGE) [Bacillus velezensis strain HKSSLJEBR3]
MLNGNKGFSTIETLSAMAVWLFLMTSIIPVWTGMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=1107243 ACM5XX_RS12175 WP_041481885.1 2492972..2493286(-) (comGE) [Bacillus velezensis strain HKSSLJEBR3]
ATGCTAAACGGAAATAAAGGGTTCTCTACTATTGAAACACTATCAGCAATGGCCGTTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGCTGACAGATGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCGCGGCGAAAAAGAAATGTGTCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481

Multiple sequence alignment