Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   ACN6IU_RS11465 Genome accession   NZ_CP183804
Coordinates   2233477..2233941 (-) Length   154 a.a.
NCBI ID   WP_016570065.1    Uniprot ID   -
Organism   Pasteurella multocida strain 171865     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2227958..2278182 2233477..2233941 within 0


Gene organization within MGE regions


Location: 2227958..2278182
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACN6IU_RS11410 - 2227958..2228947 (+) 990 WP_195188432.1 tyrosine-type recombinase/integrase -
  ACN6IU_RS11415 - 2228944..2229225 (-) 282 WP_047918098.1 hypothetical protein -
  ACN6IU_RS11420 - 2229264..2229560 (-) 297 WP_139617331.1 hypothetical protein -
  ACN6IU_RS11425 - 2229565..2230035 (-) 471 WP_250021891.1 pyruvate kinase -
  ACN6IU_RS11430 - 2230039..2230335 (-) 297 WP_015691047.1 hypothetical protein -
  ACN6IU_RS11435 - 2230380..2230736 (-) 357 WP_015691049.1 hypothetical protein -
  ACN6IU_RS11440 - 2230745..2231233 (-) 489 WP_419731318.1 DUF551 domain-containing protein -
  ACN6IU_RS11445 - 2231368..2231967 (-) 600 WP_419731319.1 hypothetical protein -
  ACN6IU_RS11450 - 2232018..2232806 (-) 789 WP_014391448.1 DUF2303 family protein -
  ACN6IU_RS11455 - 2232878..2233231 (-) 354 WP_016570064.1 hypothetical protein -
  ACN6IU_RS11460 - 2233274..2233465 (-) 192 WP_016533530.1 hypothetical protein -
  ACN6IU_RS11465 ssb 2233477..2233941 (-) 465 WP_016570065.1 single-stranded DNA-binding protein Machinery gene
  ACN6IU_RS11470 - 2233945..2234556 (-) 612 WP_064775601.1 YqaJ viral recombinase family protein -
  ACN6IU_RS11475 bet 2234549..2235400 (-) 852 WP_016533454.1 phage recombination protein Bet -
  ACN6IU_RS11480 - 2235404..2236390 (-) 987 WP_016570067.1 hypothetical protein -
  ACN6IU_RS11485 - 2236393..2236554 (-) 162 WP_014390707.1 hypothetical protein -
  ACN6IU_RS11490 - 2236568..2236804 (-) 237 WP_016570068.1 hypothetical protein -
  ACN6IU_RS11495 - 2236791..2237075 (-) 285 WP_016570069.1 hypothetical protein -
  ACN6IU_RS11500 - 2237223..2237453 (+) 231 WP_223251317.1 hypothetical protein -
  ACN6IU_RS11505 - 2237515..2238156 (-) 642 WP_419731320.1 Bro-N domain-containing protein -
  ACN6IU_RS11510 - 2238441..2239277 (-) 837 WP_014390712.1 KilA-N domain-containing protein -
  ACN6IU_RS11515 - 2239489..2239614 (+) 126 WP_014391103.1 hypothetical protein -
  ACN6IU_RS11520 - 2239615..2240148 (-) 534 WP_014391102.1 hypothetical protein -
  ACN6IU_RS11525 - 2240236..2240499 (-) 264 WP_014391456.1 hypothetical protein -
  ACN6IU_RS11530 - 2240724..2240954 (-) 231 WP_016533507.1 hypothetical protein -
  ACN6IU_RS11535 - 2241568..2241951 (-) 384 WP_016533476.1 hypothetical protein -
  ACN6IU_RS11540 - 2241948..2242427 (-) 480 WP_016533477.1 type II toxin-antitoxin system HicB family antitoxin -
  ACN6IU_RS11545 - 2242430..2242693 (-) 264 WP_016533478.1 type II toxin-antitoxin system HicA family toxin -
  ACN6IU_RS11550 - 2242876..2243553 (-) 678 WP_016569989.1 XRE family transcriptional regulator -
  ACN6IU_RS11555 - 2243677..2243874 (+) 198 WP_014390719.1 helix-turn-helix domain-containing protein -
  ACN6IU_RS11560 - 2243923..2244375 (+) 453 WP_419731321.1 phage regulatory CII family protein -
  ACN6IU_RS11565 - 2244442..2244576 (+) 135 WP_016569987.1 hypothetical protein -
  ACN6IU_RS11570 - 2244628..2244808 (+) 181 Protein_2244 hypothetical protein -
  ACN6IU_RS11575 - 2244885..2245238 (+) 354 WP_014390722.1 HNH endonuclease -
  ACN6IU_RS11580 - 2245240..2246142 (+) 903 WP_016533442.1 hypothetical protein -
  ACN6IU_RS11585 - 2246142..2246831 (+) 690 WP_419731389.1 replication protein P -
  ACN6IU_RS11590 - 2246835..2247371 (+) 537 WP_267750703.1 phage N-6-adenine-methyltransferase -
  ACN6IU_RS11595 - 2247361..2247819 (+) 459 WP_267750701.1 recombination protein NinB -
  ACN6IU_RS11600 - 2247893..2248474 (+) 582 WP_139638721.1 recombination protein NinG -
  ACN6IU_RS11605 - 2248471..2248974 (+) 504 WP_228767745.1 antiterminator Q family protein -
  ACN6IU_RS11610 - 2249095..2249289 (+) 195 WP_064964940.1 hypothetical protein -
  ACN6IU_RS11615 - 2249325..2249882 (-) 558 WP_079157770.1 hypothetical protein -
  ACN6IU_RS11620 - 2249999..2250259 (+) 261 WP_014391475.1 HP1 family phage holin -
  ACN6IU_RS11625 - 2250256..2250786 (+) 531 WP_005725607.1 lysozyme -
  ACN6IU_RS11630 - 2250759..2251082 (+) 324 WP_419731322.1 DUF2570 family protein -
  ACN6IU_RS11635 lysC 2250988..2251269 (+) 282 WP_419731323.1 Rz1-like lysis system protein LysC -
  ACN6IU_RS11640 - 2251304..2251738 (-) 435 WP_014390736.1 type II toxin-antitoxin system HicB family antitoxin -
  ACN6IU_RS11645 - 2251767..2251949 (-) 183 WP_016533497.1 type II toxin-antitoxin system HicA family toxin -
  ACN6IU_RS11650 - 2252032..2252529 (+) 498 WP_014390737.1 terminase -
  ACN6IU_RS11655 - 2252513..2253748 (+) 1236 WP_419731324.1 PBSX family phage terminase large subunit -
  ACN6IU_RS11660 - 2253758..2255161 (+) 1404 WP_015691068.1 DUF4055 domain-containing protein -
  ACN6IU_RS11665 - 2255151..2256752 (+) 1602 WP_419731325.1 minor capsid protein -
  ACN6IU_RS11670 - 2256755..2256973 (+) 219 WP_015691070.1 hypothetical protein -
  ACN6IU_RS11675 - 2256948..2257382 (+) 435 WP_015691071.1 HD domain-containing protein -
  ACN6IU_RS11680 - 2257422..2257589 (+) 168 WP_016533111.1 hypothetical protein -
  ACN6IU_RS11685 - 2257717..2258502 (+) 786 WP_238300405.1 hypothetical protein -
  ACN6IU_RS11690 - 2258520..2259677 (+) 1158 WP_064964915.1 P22 phage major capsid protein family protein -
  ACN6IU_RS11695 - 2259735..2259971 (+) 237 WP_238300401.1 HeH/LEM domain-containing protein -
  ACN6IU_RS11700 - 2259988..2260455 (+) 468 WP_015691076.1 DnaT-like ssDNA-binding protein -
  ACN6IU_RS11705 - 2260457..2260831 (+) 375 WP_015691077.1 hypothetical protein -
  ACN6IU_RS11710 - 2260833..2261234 (+) 402 WP_016533105.1 HK97 gp10 family phage protein -
  ACN6IU_RS11715 - 2261234..2261626 (+) 393 WP_015691079.1 phage tail terminator-like protein -
  ACN6IU_RS11720 - 2261639..2262655 (+) 1017 WP_016533104.1 phage tail tube protein -
  ACN6IU_RS11725 - 2262728..2263144 (+) 417 WP_016533103.1 hypothetical protein -
  ACN6IU_RS11730 - 2263258..2263473 (+) 216 WP_419731390.1 phage tail assembly chaperone -
  ACN6IU_RS11735 - 2263490..2263843 (+) 354 WP_231140379.1 phage tail protein -
  ACN6IU_RS11740 - 2264148..2264843 (+) 696 WP_238300398.1 hypothetical protein -
  ACN6IU_RS11745 - 2264966..2267680 (+) 2715 WP_064775656.1 tape measure protein -
  ACN6IU_RS11750 - 2267677..2268381 (+) 705 WP_139617304.1 phage minor tail protein L -
  ACN6IU_RS11755 - 2268386..2269129 (+) 744 WP_102827075.1 C40 family peptidase -
  ACN6IU_RS11760 - 2269072..2269662 (+) 591 WP_419731326.1 tail assembly protein -
  ACN6IU_RS11765 gpJ 2269666..2275560 (+) 5895 WP_419731327.1 TipJ family phage tail tip protein -
  ACN6IU_RS11770 - 2275608..2275931 (+) 324 WP_139616918.1 hypothetical protein -
  ACN6IU_RS11775 - 2276357..2277193 (+) 837 WP_014390712.1 KilA-N domain-containing protein -
  ACN6IU_RS11780 - 2277496..2278182 (+) 687 WP_250021904.1 KilA-N domain-containing protein -

Sequence


Protein


Download         Length: 154 a.a.        Molecular weight: 17207.00 Da        Isoelectric Point: 6.9818

>NTDB_id=1106200 ACN6IU_RS11465 WP_016570065.1 2233477..2233941(-) (ssb) [Pasteurella multocida strain 171865]
MAGVNKVIIVGNLGNDPDVRTMPNGDAVAKISVATSESWIDKNTNERKTQTEWHSIVFYRRQAEICGQYLKKGSKVYVEG
RLRTRKWQDQNGQDRYTTEIQGDVLQMLDSRQDSQAQANAQANAQAPQNNAYANAKAGKPVQQADSFEDDSIPF

Nucleotide


Download         Length: 465 bp        

>NTDB_id=1106200 ACN6IU_RS11465 WP_016570065.1 2233477..2233941(-) (ssb) [Pasteurella multocida strain 171865]
ATGGCTGGGGTAAATAAAGTAATTATCGTCGGGAATTTGGGAAACGATCCTGATGTCCGCACAATGCCAAATGGCGACGC
AGTGGCAAAAATTAGTGTGGCCACGAGCGAAAGTTGGATCGACAAAAACACGAACGAGCGAAAAACGCAGACAGAATGGC
ACTCTATCGTGTTTTATCGCCGCCAAGCAGAAATTTGCGGGCAGTATCTCAAAAAAGGATCGAAAGTGTATGTGGAAGGG
CGTTTAAGAACTCGTAAATGGCAAGACCAAAACGGGCAAGACCGCTACACCACTGAAATCCAAGGCGACGTATTGCAGAT
GTTAGACAGTCGCCAAGATTCACAAGCACAAGCTAACGCACAAGCTAACGCACAAGCACCGCAAAACAATGCTTATGCCA
ATGCGAAAGCTGGAAAGCCAGTGCAACAGGCTGATAGTTTTGAAGATGATAGCATACCTTTTTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Glaesserella parasuis strain SC1401

62.983

100

0.74

  ssb Vibrio cholerae strain A1552

48.276

100

0.545

  ssb Neisseria meningitidis MC58

42.775

100

0.481

  ssb Neisseria gonorrhoeae MS11

42.775

100

0.481


Multiple sequence alignment