Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | ACN2W4_RS20915 | Genome accession | NZ_CP183425 |
| Coordinates | 4371371..4371826 (-) | Length | 151 a.a. |
| NCBI ID | WP_419686120.1 | Uniprot ID | - |
| Organism | Serratia marcescens strain H-12-3 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 4364100..4405267 | 4371371..4371826 | within | 0 |
Gene organization within MGE regions
Location: 4364100..4405267
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACN2W4_RS20855 (ACN2W4_20855) | rseC | 4364100..4364576 (+) | 477 | WP_049200768.1 | SoxR-reducing system protein RseC | - |
| ACN2W4_RS20860 (ACN2W4_20860) | - | 4364573..4365409 (-) | 837 | WP_419686109.1 | hypothetical protein | - |
| ACN2W4_RS20865 (ACN2W4_20865) | - | 4366174..4367403 (+) | 1230 | WP_103687124.1 | tyrosine-type recombinase/integrase | - |
| ACN2W4_RS20870 (ACN2W4_20870) | xis | 4367381..4367653 (-) | 273 | WP_075204068.1 | excisionase Xis | - |
| ACN2W4_RS20875 (ACN2W4_20875) | - | 4367810..4368472 (-) | 663 | WP_419686110.1 | MT-A70 family methyltransferase | - |
| ACN2W4_RS20880 (ACN2W4_20880) | - | 4368469..4368657 (-) | 189 | WP_419686111.1 | ANR family transcriptional regulator | - |
| ACN2W4_RS20885 (ACN2W4_20885) | - | 4368672..4369049 (-) | 378 | WP_419686113.1 | hypothetical protein | - |
| ACN2W4_RS20890 (ACN2W4_20890) | - | 4369052..4369261 (-) | 210 | WP_419686114.1 | hypothetical protein | - |
| ACN2W4_RS20895 (ACN2W4_20895) | - | 4369274..4369492 (-) | 219 | WP_419686116.1 | hypothetical protein | - |
| ACN2W4_RS20900 (ACN2W4_20900) | - | 4369470..4370207 (-) | 738 | WP_419686118.1 | hypothetical protein | - |
| ACN2W4_RS20905 (ACN2W4_20905) | - | 4370402..4370590 (-) | 189 | Protein_4070 | hypothetical protein | - |
| ACN2W4_RS20910 (ACN2W4_20910) | - | 4370587..4371162 (-) | 576 | WP_419686119.1 | hypothetical protein | - |
| ACN2W4_RS20915 (ACN2W4_20915) | ssb | 4371371..4371826 (-) | 456 | WP_419686120.1 | single-stranded DNA-binding protein | Machinery gene |
| ACN2W4_RS20920 (ACN2W4_20920) | - | 4371827..4372444 (-) | 618 | WP_193158753.1 | ERF family protein | - |
| ACN2W4_RS20925 (ACN2W4_20925) | - | 4372454..4372621 (-) | 168 | WP_419686121.1 | hypothetical protein | - |
| ACN2W4_RS20930 (ACN2W4_20930) | - | 4372618..4372818 (-) | 201 | WP_419686122.1 | hypothetical protein | - |
| ACN2W4_RS20935 (ACN2W4_20935) | - | 4372928..4373065 (-) | 138 | WP_129992930.1 | protease FtsH-inhibitory lysogeny factor CIII | - |
| ACN2W4_RS20940 (ACN2W4_20940) | - | 4373090..4374070 (-) | 981 | WP_419687779.1 | hypothetical protein | - |
| ACN2W4_RS20945 (ACN2W4_20945) | - | 4374275..4374628 (-) | 354 | WP_419686124.1 | DUF551 domain-containing protein | - |
| ACN2W4_RS20950 (ACN2W4_20950) | - | 4374594..4375208 (-) | 615 | WP_419686125.1 | pentapeptide repeat-containing protein | - |
| ACN2W4_RS20955 (ACN2W4_20955) | - | 4375286..4375768 (-) | 483 | WP_419686127.1 | hypothetical protein | - |
| ACN2W4_RS20960 (ACN2W4_20960) | - | 4375786..4376034 (-) | 249 | WP_115116562.1 | hypothetical protein | - |
| ACN2W4_RS20965 (ACN2W4_20965) | - | 4376560..4376775 (+) | 216 | WP_419686129.1 | DUF2767 domain-containing protein | - |
| ACN2W4_RS20970 (ACN2W4_20970) | - | 4376833..4376955 (-) | 123 | WP_419686130.1 | hypothetical protein | - |
| ACN2W4_RS20975 (ACN2W4_20975) | - | 4376983..4377345 (-) | 363 | WP_308323027.1 | hypothetical protein | - |
| ACN2W4_RS20980 (ACN2W4_20980) | - | 4377621..4378307 (-) | 687 | WP_354633454.1 | LexA family protein | - |
| ACN2W4_RS20985 (ACN2W4_20985) | - | 4378424..4378657 (+) | 234 | WP_147839106.1 | transcriptional regulator | - |
| ACN2W4_RS20990 (ACN2W4_20990) | - | 4378772..4379059 (+) | 288 | WP_311266380.1 | CII family transcriptional regulator | - |
| ACN2W4_RS20995 (ACN2W4_20995) | - | 4379139..4380050 (+) | 912 | WP_419686132.1 | replication protein | - |
| ACN2W4_RS21000 (ACN2W4_21000) | - | 4380047..4380775 (+) | 729 | WP_419686134.1 | ATP-binding protein | - |
| ACN2W4_RS21005 (ACN2W4_21005) | - | 4380816..4381001 (+) | 186 | WP_346420511.1 | hypothetical protein | - |
| ACN2W4_RS21010 (ACN2W4_21010) | - | 4381005..4381454 (+) | 450 | WP_419686136.1 | DUF1367 family protein | - |
| ACN2W4_RS21015 (ACN2W4_21015) | - | 4381677..4381796 (+) | 120 | WP_419687781.1 | protein NinF | - |
| ACN2W4_RS21020 (ACN2W4_21020) | - | 4381789..4382391 (+) | 603 | WP_419686138.1 | recombination protein NinG | - |
| ACN2W4_RS21025 (ACN2W4_21025) | - | 4382388..4383002 (+) | 615 | WP_060452292.1 | hypothetical protein | - |
| ACN2W4_RS21030 (ACN2W4_21030) | - | 4383502..4383849 (+) | 348 | WP_419686139.1 | phage holin, lambda family | - |
| ACN2W4_RS21035 (ACN2W4_21035) | - | 4383836..4384276 (+) | 441 | WP_419686140.1 | lysozyme | - |
| ACN2W4_RS21040 (ACN2W4_21040) | - | 4384309..4384716 (+) | 408 | WP_419686141.1 | lysis protein | - |
| ACN2W4_RS21045 (ACN2W4_21045) | - | 4384758..4384967 (-) | 210 | WP_342188080.1 | hypothetical protein | - |
| ACN2W4_RS21050 (ACN2W4_21050) | - | 4384970..4385542 (-) | 573 | WP_342188078.1 | hypothetical protein | - |
| ACN2W4_RS21055 (ACN2W4_21055) | - | 4385729..4386337 (+) | 609 | WP_419686142.1 | terminase small subunit | - |
| ACN2W4_RS21060 (ACN2W4_21060) | - | 4386560..4388182 (+) | 1623 | WP_197810730.1 | TerL protein | - |
| ACN2W4_RS21065 (ACN2W4_21065) | - | 4388182..4389648 (+) | 1467 | WP_419686143.1 | DUF1073 domain-containing protein | - |
| ACN2W4_RS21070 (ACN2W4_21070) | - | 4389704..4390252 (+) | 549 | WP_197837123.1 | phage minor head protein | - |
| ACN2W4_RS21075 (ACN2W4_21075) | - | 4390513..4391745 (+) | 1233 | WP_419686144.1 | DUF2213 domain-containing protein | - |
| ACN2W4_RS21080 (ACN2W4_21080) | - | 4391750..4392247 (+) | 498 | WP_419686145.1 | structural cement protein Gp24 | - |
| ACN2W4_RS21085 (ACN2W4_21085) | - | 4392259..4393200 (+) | 942 | WP_060417776.1 | DUF2184 domain-containing protein | - |
| ACN2W4_RS21090 (ACN2W4_21090) | - | 4393242..4393640 (+) | 399 | WP_197837041.1 | STY1053 family phage-associated protein | - |
| ACN2W4_RS21095 (ACN2W4_21095) | - | 4393621..4394034 (+) | 414 | WP_419686146.1 | DUF4054 domain-containing protein | - |
| ACN2W4_RS21100 (ACN2W4_21100) | - | 4394031..4394537 (+) | 507 | WP_419686147.1 | hypothetical protein | - |
| ACN2W4_RS21105 (ACN2W4_21105) | - | 4394537..4394923 (+) | 387 | WP_060425166.1 | hypothetical protein | - |
| ACN2W4_RS21110 (ACN2W4_21110) | - | 4394916..4395458 (+) | 543 | WP_374991390.1 | LIC_12616 family protein | - |
| ACN2W4_RS21115 (ACN2W4_21115) | - | 4395461..4396945 (+) | 1485 | WP_419686148.1 | DUF3383 domain-containing protein | - |
| ACN2W4_RS21120 (ACN2W4_21120) | - | 4396957..4397397 (+) | 441 | WP_419686149.1 | DUF3277 family protein | - |
| ACN2W4_RS21125 (ACN2W4_21125) | - | 4397408..4397806 (+) | 399 | WP_419686150.1 | phage tail assembly chaperone | - |
| ACN2W4_RS21130 (ACN2W4_21130) | - | 4397842..4397994 (+) | 153 | WP_060425156.1 | DUF6889 family protein | - |
| ACN2W4_RS21135 (ACN2W4_21135) | - | 4397984..4399975 (+) | 1992 | WP_419686151.1 | lytic transglycosylase domain-containing protein | - |
| ACN2W4_RS21140 (ACN2W4_21140) | - | 4399977..4400609 (+) | 633 | WP_060425152.1 | phage baseplate protein | - |
| ACN2W4_RS21145 (ACN2W4_21145) | - | 4400606..4400911 (+) | 306 | WP_060432009.1 | phage baseplate plug family protein | - |
| ACN2W4_RS21150 (ACN2W4_21150) | - | 4400915..4401991 (+) | 1077 | WP_419686152.1 | hypothetical protein | - |
| ACN2W4_RS21155 (ACN2W4_21155) | - | 4401995..4402339 (+) | 345 | WP_060425146.1 | hypothetical protein | - |
| ACN2W4_RS21160 (ACN2W4_21160) | - | 4402404..4403162 (+) | 759 | WP_419686154.1 | Gp138 family membrane-puncturing spike protein | - |
| ACN2W4_RS21165 (ACN2W4_21165) | - | 4403159..4403509 (+) | 351 | WP_015377530.1 | hypothetical protein | - |
| ACN2W4_RS21170 (ACN2W4_21170) | - | 4403502..4404692 (+) | 1191 | WP_419686155.1 | baseplate J/gp47 family protein | - |
| ACN2W4_RS21175 (ACN2W4_21175) | - | 4404689..4405267 (+) | 579 | WP_419686156.1 | DUF2612 domain-containing protein | - |
Sequence
Protein
Download Length: 151 a.a. Molecular weight: 16750.75 Da Isoelectric Point: 7.2030
>NTDB_id=1105717 ACN2W4_RS20915 WP_419686120.1 4371371..4371826(-) (ssb) [Serratia marcescens strain H-12-3]
MASKGINKAIIIGNLGKDPEVRYTQTGGAIANLTIATSESWRDKQSGEQKEKTEWHRVVLFGKLAEVAGEYLRKGSQVYI
EGKLTTRKWADQAGVERYTTEIHVNVGGVMQMIGSKQEASQSGNQQSPPKQQNKPQQSNEPPMDFDDDIPF
MASKGINKAIIIGNLGKDPEVRYTQTGGAIANLTIATSESWRDKQSGEQKEKTEWHRVVLFGKLAEVAGEYLRKGSQVYI
EGKLTTRKWADQAGVERYTTEIHVNVGGVMQMIGSKQEASQSGNQQSPPKQQNKPQQSNEPPMDFDDDIPF
Nucleotide
Download Length: 456 bp
>NTDB_id=1105717 ACN2W4_RS20915 WP_419686120.1 4371371..4371826(-) (ssb) [Serratia marcescens strain H-12-3]
ATGGCTAGTAAAGGCATCAACAAAGCAATCATCATCGGCAACCTAGGTAAAGATCCAGAGGTTCGCTACACGCAAACTGG
TGGCGCTATCGCCAACCTGACAATTGCCACCTCTGAATCGTGGCGTGATAAACAATCTGGCGAGCAAAAGGAAAAGACCG
AATGGCACCGCGTGGTGCTGTTCGGAAAACTGGCTGAGGTTGCCGGCGAGTATCTTCGAAAAGGCTCGCAGGTTTATATC
GAAGGAAAACTGACAACACGCAAGTGGGCAGATCAGGCTGGCGTTGAGCGCTATACGACAGAGATTCATGTCAATGTCGG
CGGCGTGATGCAAATGATCGGCAGCAAGCAAGAAGCATCGCAATCAGGAAATCAGCAGTCGCCACCTAAGCAGCAAAATA
AACCTCAACAGTCGAATGAGCCACCTATGGACTTCGACGACGATATTCCCTTCTAG
ATGGCTAGTAAAGGCATCAACAAAGCAATCATCATCGGCAACCTAGGTAAAGATCCAGAGGTTCGCTACACGCAAACTGG
TGGCGCTATCGCCAACCTGACAATTGCCACCTCTGAATCGTGGCGTGATAAACAATCTGGCGAGCAAAAGGAAAAGACCG
AATGGCACCGCGTGGTGCTGTTCGGAAAACTGGCTGAGGTTGCCGGCGAGTATCTTCGAAAAGGCTCGCAGGTTTATATC
GAAGGAAAACTGACAACACGCAAGTGGGCAGATCAGGCTGGCGTTGAGCGCTATACGACAGAGATTCATGTCAATGTCGG
CGGCGTGATGCAAATGATCGGCAGCAAGCAAGAAGCATCGCAATCAGGAAATCAGCAGTCGCCACCTAAGCAGCAAAATA
AACCTCAACAGTCGAATGAGCCACCTATGGACTTCGACGACGATATTCCCTTCTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Vibrio cholerae strain A1552 |
60.112 |
100 |
0.709 |
| ssb | Glaesserella parasuis strain SC1401 |
48.619 |
100 |
0.583 |
| ssb | Neisseria meningitidis MC58 |
39.205 |
100 |
0.457 |
| ssb | Neisseria gonorrhoeae MS11 |
39.205 |
100 |
0.457 |