Detailed information NTG1105083

Bioinformatically predicted

Overview

• Name: comGD
• Type: Machinery gene
• Locus tag: ACNR9X_RS12005
• Genome accession: NZ_CP183293
• Coordinates: 2479251..2479688 (-)
• Length: 145 a.a.
• NCBI ID: WP_044053464.1
• Uniprot ID: -
• Organism: Bacillus velezensis strain F68
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2474251..2484688

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
ACNR9X_RS11955 (ACNR9X_11955)	sinI	2474635..2474808 (+)	174	WP_003153105.1	anti-repressor SinI	Regulator
ACNR9X_RS11960 (ACNR9X_11960)	sinR	2474842..2475177 (+)	336	WP_003153104.1	transcriptional regulator SinR	Regulator
ACNR9X_RS11965 (ACNR9X_11965)	tasA	2475225..2476010 (-)	786	WP_003153102.1	biofilm matrix protein TasA	-
ACNR9X_RS11970 (ACNR9X_11970)	sipW	2476074..2476658 (-)	585	WP_012117977.1	signal peptidase I SipW	-
ACNR9X_RS11975 (ACNR9X_11975)	tapA	2476630..2477301 (-)	672	WP_024085598.1	amyloid fiber anchoring/assembly protein TapA	-
ACNR9X_RS11980 (ACNR9X_11980)	-	2477561..2477890 (+)	330	WP_003153097.1	DUF3889 domain-containing protein	-
ACNR9X_RS11985 (ACNR9X_11985)	-	2477930..2478109 (-)	180	WP_003153093.1	YqzE family protein	-
ACNR9X_RS11990 (ACNR9X_11990)	comGG	2478166..2478543 (-)	378	WP_014305410.1	competence type IV pilus minor pilin ComGG	Machinery gene
ACNR9X_RS11995 (ACNR9X_11995)	comGF	2478544..2479044 (-)	501	WP_224979425.1	competence type IV pilus minor pilin ComGF	-
ACNR9X_RS12000 (ACNR9X_12000)	comGE	2478953..2479267 (-)	315	WP_015388003.1	competence type IV pilus minor pilin ComGE	Machinery gene
ACNR9X_RS12005 (ACNR9X_12005)	comGD	2479251..2479688 (-)	438	WP_044053464.1	competence type IV pilus minor pilin ComGD	Machinery gene
ACNR9X_RS12010 (ACNR9X_12010)	comGC	2479678..2479986 (-)	309	WP_003153087.1	competence type IV pilus major pilin ComGC	Machinery gene
ACNR9X_RS12015 (ACNR9X_12015)	comGB	2479991..2481028 (-)	1038	WP_024085602.1	competence type IV pilus assembly protein ComGB	Machinery gene
ACNR9X_RS12020 (ACNR9X_12020)	comGA	2481015..2482085 (-)	1071	WP_044053465.1	competence type IV pilus ATPase ComGA	Machinery gene
ACNR9X_RS12025 (ACNR9X_12025)	-	2482277..2483227 (-)	951	WP_014305415.1	magnesium transporter CorA family protein	-
ACNR9X_RS12030 (ACNR9X_12030)	-	2483373..2484674 (+)	1302	WP_014305416.1	hemolysin family protein	-

Sequence

Protein

• Length: 145 a.a.
• Molecular weight: 16282.81 Da
• Isoelectric Point: 10.3354

>NTDB_id=1105083 ACNR9X_RS12005 WP_044053464.1 2479251..2479688(-) (comGD) [Bacillus velezensis strain F68]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPVCTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIRLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide

• Length: 438 bp

>NTDB_id=1105083 ACNR9X_RS12005 WP_044053464.1 2479251..2479688(-) (comGD) [Bacillus velezensis strain F68]
TTGAACAATAACAGGCGGACAGAAAACGGGTTTACTCTTCTTGAAAGCCTGATTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGTCTGCACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTTCAAAAAGATA
TTCAGCTTGCGCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAGGCGGTAGGATTGTCGAGCGTTCTTTTGATTCGCTTCACATTACACTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATTCGATTGAAGAGCGCCGGGTTCACCTATGAGATCACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (5-31)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGD	Bacillus subtilis subsp. subtilis str. 168	56.164	100	0.566