Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | ACNR9X_RS11955 | Genome accession | NZ_CP183293 |
| Coordinates | 2474635..2474808 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain F68 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2469635..2479808
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACNR9X_RS11940 (ACNR9X_11940) | gcvT | 2470453..2471553 (-) | 1101 | WP_058906182.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| ACNR9X_RS11945 (ACNR9X_11945) | - | 2471976..2473646 (+) | 1671 | WP_058906183.1 | DEAD/DEAH box helicase | - |
| ACNR9X_RS11950 (ACNR9X_11950) | - | 2473664..2474458 (+) | 795 | WP_003153106.1 | YqhG family protein | - |
| ACNR9X_RS11955 (ACNR9X_11955) | sinI | 2474635..2474808 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| ACNR9X_RS11960 (ACNR9X_11960) | sinR | 2474842..2475177 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| ACNR9X_RS11965 (ACNR9X_11965) | tasA | 2475225..2476010 (-) | 786 | WP_003153102.1 | biofilm matrix protein TasA | - |
| ACNR9X_RS11970 (ACNR9X_11970) | sipW | 2476074..2476658 (-) | 585 | WP_012117977.1 | signal peptidase I SipW | - |
| ACNR9X_RS11975 (ACNR9X_11975) | tapA | 2476630..2477301 (-) | 672 | WP_024085598.1 | amyloid fiber anchoring/assembly protein TapA | - |
| ACNR9X_RS11980 (ACNR9X_11980) | - | 2477561..2477890 (+) | 330 | WP_003153097.1 | DUF3889 domain-containing protein | - |
| ACNR9X_RS11985 (ACNR9X_11985) | - | 2477930..2478109 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| ACNR9X_RS11990 (ACNR9X_11990) | comGG | 2478166..2478543 (-) | 378 | WP_014305410.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| ACNR9X_RS11995 (ACNR9X_11995) | comGF | 2478544..2479044 (-) | 501 | WP_224979425.1 | competence type IV pilus minor pilin ComGF | - |
| ACNR9X_RS12000 (ACNR9X_12000) | comGE | 2478953..2479267 (-) | 315 | WP_015388003.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| ACNR9X_RS12005 (ACNR9X_12005) | comGD | 2479251..2479688 (-) | 438 | WP_044053464.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=1105079 ACNR9X_RS11955 WP_003153105.1 2474635..2474808(+) (sinI) [Bacillus velezensis strain F68]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=1105079 ACNR9X_RS11955 WP_003153105.1 2474635..2474808(+) (sinI) [Bacillus velezensis strain F68]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |