Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   ACAK32_RS05750 Genome accession   NZ_AP031580
Coordinates   1175634..1175735 (+) Length   33 a.a.
NCBI ID   WP_168713084.1    Uniprot ID   -
Organism   Acinetobacter baumannii strain JUNP419     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1110533..1176471 1175634..1175735 within 0


Gene organization within MGE regions


Location: 1110533..1176471
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACAK32_RS05430 (JUNP419_1098) - 1110934..1111494 (-) 561 WP_001048150.1 hypothetical protein -
  ACAK32_RS05435 (JUNP419_1099) - 1111585..1112445 (-) 861 WP_000838098.1 pirin family protein -
  ACAK32_RS05440 (JUNP419_1100) hemJ 1112616..1113068 (-) 453 WP_000339889.1 protoporphyrinogen oxidase HemJ -
  ACAK32_RS05445 (JUNP419_1101) - 1113087..1114316 (-) 1230 WP_000832710.1 beta-ketoacyl-ACP synthase II -
  ACAK32_RS05450 (JUNP419_1102) - 1114613..1115938 (+) 1326 WP_000160011.1 EcsC family protein -
  ACAK32_RS05455 (JUNP419_1103) rpsL 1116139..1116513 (+) 375 WP_000246374.1 30S ribosomal protein S12 -
  ACAK32_RS05460 (JUNP419_1104) rpsG 1116673..1117143 (+) 471 WP_001138055.1 30S ribosomal protein S7 -
  ACAK32_RS05465 (JUNP419_1105) fusA 1117322..1119460 (+) 2139 WP_000113824.1 elongation factor G -
  ACAK32_RS05470 (JUNP419_1106) tuf 1119555..1120745 (+) 1191 WP_001029610.1 elongation factor Tu -
  ACAK32_RS05475 (JUNP419_1107) - 1120949..1121830 (+) 882 WP_000992305.1 metal-dependent hydrolase -
  ACAK32_RS05480 (JUNP419_1108) - 1122067..1122942 (+) 876 WP_000992291.1 metal-dependent hydrolase -
  ACAK32_RS05485 (JUNP419_1109) rimI 1123051..1123506 (+) 456 WP_000621543.1 ribosomal protein S18-alanine N-acetyltransferase -
  ACAK32_RS05490 (JUNP419_1110) - 1123551..1124366 (-) 816 WP_000844343.1 arginyltransferase -
  ACAK32_RS05495 (JUNP419_1111) aat 1124385..1125116 (-) 732 WP_000854785.1 leucyl/phenylalanyl-tRNA--protein transferase -
  ACAK32_RS05500 (JUNP419_1112) trxB 1125236..1126183 (-) 948 WP_001276144.1 thioredoxin-disulfide reductase -
  ACAK32_RS05505 (JUNP419_1113) - 1126453..1129485 (+) 3033 WP_000127823.1 DNA translocase FtsK -
  ACAK32_RS05510 (JUNP419_1114) rhtC 1129635..1130255 (+) 621 WP_000959259.1 threonine export protein RhtC -
  ACAK32_RS05515 (JUNP419_1115) - 1130311..1130841 (-) 531 WP_031969348.1 tyrosyl-tRNA synthetase -
  ACAK32_RS05520 (JUNP419_1116) - 1130793..1131095 (-) 303 WP_024435458.1 hypothetical protein -
  ACAK32_RS05525 (JUNP419_1117) - 1131243..1131530 (-) 288 WP_001218560.1 PA4642 family protein -
  ACAK32_RS05530 (JUNP419_1118) minE 1131614..1131886 (-) 273 WP_000896934.1 cell division topological specificity factor MinE -
  ACAK32_RS05535 (JUNP419_1119) minD 1131889..1132701 (-) 813 WP_001074362.1 septum site-determining protein MinD -
  ACAK32_RS05540 (JUNP419_1120) minC 1132772..1133494 (-) 723 WP_000763677.1 septum site-determining protein MinC -
  ACAK32_RS05545 (JUNP419_1121) - 1133616..1134662 (-) 1047 WP_001181639.1 hypothetical protein -
  ACAK32_RS05550 (JUNP419_1122) - 1134679..1135605 (-) 927 WP_000100965.1 acyltransferase -
  ACAK32_RS05555 (JUNP419_1123) - 1135850..1136503 (+) 654 WP_001202415.1 OmpA family protein -
  ACAK32_RS05560 (JUNP419_1124) rep 1136697..1138736 (+) 2040 WP_000093035.1 DNA helicase Rep -
  ACAK32_RS05565 (JUNP419_1125) dut 1138761..1139213 (+) 453 WP_000868152.1 dUTP diphosphatase -
  ACAK32_RS05570 (JUNP419_1126) - 1139413..1140831 (+) 1419 WP_001102845.1 phosphomannomutase/phosphoglucomutase -
  ACAK32_RS05575 (JUNP419_1127) argB 1140846..1141754 (+) 909 WP_001135419.1 acetylglutamate kinase -
  ACAK32_RS05580 (JUNP419_1128) - 1141875..1142657 (+) 783 WP_000890283.1 GNAT family N-acetyltransferase -
  ACAK32_RS05585 (JUNP419_1129) - 1142766..1143614 (+) 849 WP_000336548.1 class II glutamine amidotransferase -
  ACAK32_RS05590 (JUNP419_1130) - 1143867..1144322 (+) 456 WP_000782976.1 bacteriohemerythrin -
  ACAK32_RS05595 (JUNP419_1131) - 1144475..1145542 (+) 1068 WP_002019572.1 hypothetical protein -
  ACAK32_RS05600 (JUNP419_1132) - 1145542..1145865 (+) 324 WP_000442587.1 RnfH family protein -
  ACAK32_RS05605 (JUNP419_1133) - 1145920..1146318 (-) 399 WP_001170994.1 outer membrane protein assembly factor BamE -
  ACAK32_RS05610 (JUNP419_1134) fur 1146430..1146867 (+) 438 WP_001122847.1 ferric iron uptake transcriptional regulator -
  ACAK32_RS05615 (JUNP419_1135) pilU 1146937..1148055 (-) 1119 WP_000347039.1 PilT/PilU family type 4a pilus ATPase Machinery gene
  ACAK32_RS05620 (JUNP419_1136) pilT 1148083..1149120 (-) 1038 WP_000355489.1 type IV pilus twitching motility protein PilT Machinery gene
  ACAK32_RS05625 (JUNP419_1137) - 1149247..1149939 (+) 693 WP_001108512.1 YggS family pyridoxal phosphate-dependent enzyme -
  ACAK32_RS05630 (JUNP419_1138) - 1150141..1153737 (-) 3597 WP_000698785.1 SbcC/MukB-like Walker B domain-containing protein -
  ACAK32_RS05635 (JUNP419_1139) - 1153747..1155015 (-) 1269 WP_000116701.1 exonuclease SbcCD subunit D -
  ACAK32_RS05640 (JUNP419_1140) - 1155179..1155652 (+) 474 WP_000974358.1 OsmC family protein -
  ACAK32_RS05645 (JUNP419_1141) - 1155720..1156097 (-) 378 WP_001059438.1 VOC family protein -
  ACAK32_RS05650 (JUNP419_1142) - 1156477..1156929 (+) 453 WP_000164153.1 ABZJ_00895 family protein -
  ACAK32_RS05655 (JUNP419_1143) - 1157019..1157924 (+) 906 WP_001039356.1 TIGR01777 family oxidoreductase -
  ACAK32_RS05660 (JUNP419_1144) - 1157916..1159031 (-) 1116 WP_000546701.1 FAD-binding oxidoreductase -
  ACAK32_RS05665 (JUNP419_1145) hemB 1159057..1160070 (-) 1014 WP_000222569.1 porphobilinogen synthase -
  ACAK32_RS05670 (JUNP419_1146) - 1160213..1160710 (+) 498 WP_002019577.1 thioesterase family protein -
  ACAK32_RS05675 (JUNP419_1147) - 1160980..1162131 (+) 1152 WP_000128703.1 EmrA/EmrK family multidrug efflux transporter periplasmic adaptor subunit -
  ACAK32_RS05680 (JUNP419_1148) - 1162138..1163661 (+) 1524 WP_000857095.1 DHA2 family efflux MFS transporter permease subunit -
  ACAK32_RS05685 (JUNP419_1149) ggt 1163964..1165949 (+) 1986 WP_001042923.1 gamma-glutamyltransferase -
  ACAK32_RS05695 (JUNP419_1151) - 1166651..1167880 (+) 1230 WP_001991065.1 tyrosine-type recombinase/integrase -
  ACAK32_RS05700 (JUNP419_1152) - 1168028..1168795 (+) 768 WP_000578618.1 hypothetical protein -
  ACAK32_RS05705 (JUNP419_1153) - 1169005..1169220 (+) 216 WP_000153154.1 hypothetical protein -
  ACAK32_RS05710 (JUNP419_1154) - 1169223..1169432 (+) 210 WP_001016479.1 helix-turn-helix domain-containing protein -
  ACAK32_RS05715 (JUNP419_1155) - 1169429..1169983 (+) 555 WP_001988245.1 BRO family protein -
  ACAK32_RS05720 (JUNP419_1156) - 1169976..1170344 (+) 369 WP_001046481.1 hypothetical protein -
  ACAK32_RS05725 (JUNP419_1157) - 1170354..1170659 (+) 306 WP_000787149.1 hypothetical protein -
  ACAK32_RS05730 (JUNP419_1158) - 1170781..1171059 (+) 279 WP_001064707.1 hypothetical protein -
  ACAK32_RS05735 (JUNP419_1159) - 1171072..1173537 (+) 2466 WP_001022397.1 DUF927 domain-containing protein -
  ACAK32_RS05740 - 1173871..1173987 (+) 117 WP_001992235.1 single-stranded DNA-binding protein -
  ACAK32_RS05745 (JUNP419_1160) - 1174210..1175652 (+) 1443 WP_369599814.1 hypothetical protein -
  ACAK32_RS05750 ssb 1175634..1175735 (+) 102 WP_168713084.1 single-stranded DNA-binding protein Machinery gene

Sequence


Protein


Download         Length: 33 a.a.        Molecular weight: 3621.22 Da        Isoelectric Point: 9.7265

>NTDB_id=110269 ACAK32_RS05750 WP_168713084.1 1175634..1175735(+) (ssb) [Acinetobacter baumannii strain JUNP419]
MVSSQLAEISSKYLKKGGKVYVEGSLCTGKWKD

Nucleotide


Download         Length: 102 bp        

>NTDB_id=110269 ACAK32_RS05750 WP_168713084.1 1175634..1175735(+) (ssb) [Acinetobacter baumannii strain JUNP419]
TTGGTTAGTTCCCAATTAGCCGAGATTTCCAGTAAGTACCTTAAGAAAGGTGGCAAGGTTTATGTTGAGGGTTCATTGTG
TACTGGGAAGTGGAAAGACTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Glaesserella parasuis strain SC1401

62.963

81.818

0.515

  ssb Vibrio cholerae strain A1552

55.172

87.879

0.485

  ssb Neisseria gonorrhoeae MS11

53.571

84.848

0.455

  ssb Neisseria meningitidis MC58

53.571

84.848

0.455


Multiple sequence alignment