Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   ACNFKI_RS16520 Genome accession   NZ_CP182571
Coordinates   3275264..3275404 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain DY201     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3270264..3280404
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACNFKI_RS16495 (ACNFKI_16495) - 3270561..3270944 (-) 384 WP_003152054.1 hotdog fold thioesterase -
  ACNFKI_RS16500 (ACNFKI_16500) comA 3270966..3271610 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  ACNFKI_RS16505 (ACNFKI_16505) comP 3271691..3273994 (-) 2304 WP_003152050.1 sensor histidine kinase Regulator
  ACNFKI_RS16510 (ACNFKI_16510) comX 3274014..3274184 (-) 171 WP_003152048.1 competence pheromone ComX Regulator
  ACNFKI_RS16515 (ACNFKI_16515) comQ 3274147..3275079 (-) 933 WP_025650217.1 class 1 isoprenoid biosynthesis enzyme Regulator
  ACNFKI_RS16520 (ACNFKI_16520) degQ 3275264..3275404 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  ACNFKI_RS16525 (ACNFKI_16525) - 3275870..3276211 (+) 342 WP_014305721.1 hypothetical protein -
  ACNFKI_RS16530 (ACNFKI_16530) - 3276218..3277438 (-) 1221 WP_003152038.1 EAL and HDOD domain-containing protein -
  ACNFKI_RS16535 (ACNFKI_16535) - 3277568..3279034 (-) 1467 WP_014305722.1 nicotinate phosphoribosyltransferase -
  ACNFKI_RS16540 (ACNFKI_16540) - 3279052..3279603 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  ACNFKI_RS16545 (ACNFKI_16545) - 3279700..3280098 (-) 399 WP_003152031.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=1102301 ACNFKI_RS16520 WP_003152043.1 3275264..3275404(-) (degQ) [Bacillus velezensis strain DY201]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1102301 ACNFKI_RS16520 WP_003152043.1 3275264..3275404(-) (degQ) [Bacillus velezensis strain DY201]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment