Detailed information    

insolico Bioinformatically predicted

Overview

Name   comX   Type   Regulator
Locus tag   ACNFKI_RS16510 Genome accession   NZ_CP182571
Coordinates   3274014..3274184 (-) Length   56 a.a.
NCBI ID   WP_003152048.1    Uniprot ID   -
Organism   Bacillus velezensis strain DY201     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context

Location: 3269014..3279184
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACNFKI_RS16480 (ACNFKI_16480) - 3269403..3269879 (+) 477 WP_003152059.1 Na+/H+ antiporter subunit E -
  ACNFKI_RS16485 (ACNFKI_16485) - 3269879..3270163 (+) 285 WP_003152057.1 Na(+)/H(+) antiporter subunit F1 -
  ACNFKI_RS16490 (ACNFKI_16490) mnhG 3270147..3270521 (+) 375 WP_003152056.1 monovalent cation/H(+) antiporter subunit G -
  ACNFKI_RS16495 (ACNFKI_16495) - 3270561..3270944 (-) 384 WP_003152054.1 hotdog fold thioesterase -
  ACNFKI_RS16500 (ACNFKI_16500) comA 3270966..3271610 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  ACNFKI_RS16505 (ACNFKI_16505) comP 3271691..3273994 (-) 2304 WP_003152050.1 sensor histidine kinase Regulator
  ACNFKI_RS16510 (ACNFKI_16510) comX 3274014..3274184 (-) 171 WP_003152048.1 competence pheromone ComX Regulator
  ACNFKI_RS16515 (ACNFKI_16515) comQ 3274147..3275079 (-) 933 WP_025650217.1 class 1 isoprenoid biosynthesis enzyme Regulator
  ACNFKI_RS16520 (ACNFKI_16520) degQ 3275264..3275404 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  ACNFKI_RS16525 (ACNFKI_16525) - 3275870..3276211 (+) 342 WP_014305721.1 hypothetical protein -
  ACNFKI_RS16530 (ACNFKI_16530) - 3276218..3277438 (-) 1221 WP_003152038.1 EAL and HDOD domain-containing protein -
  ACNFKI_RS16535 (ACNFKI_16535) - 3277568..3279034 (-) 1467 WP_014305722.1 nicotinate phosphoribosyltransferase -

Sequence

Protein


Download         Length: 56 a.a.        Molecular weight: 6574.54 Da        Isoelectric Point: 4.8018

>NTDB_id=1102299 ACNFKI_RS16510 WP_003152048.1 3274014..3274184(-) (comX) [Bacillus velezensis strain DY201]
MQNLINYFLNYPDVLKKLKSNEASLIGYDSIQTQIIIKGFENYLMMGADNKKWDNE

Nucleotide


Download         Length: 171 bp        

>NTDB_id=1102299 ACNFKI_RS16510 WP_003152048.1 3274014..3274184(-) (comX) [Bacillus velezensis strain DY201]
ATGCAGAATTTAATAAATTATTTTTTGAATTATCCTGATGTATTAAAGAAACTGAAAAGCAATGAAGCTAGCCTTATCGG
TTATGACTCTATACAAACGCAAATTATCATTAAAGGGTTTGAGAATTATTTAATGATGGGTGCGGACAATAAAAAATGGG
ATAATGAATAA

Domains

Predicted by InterproScan.

Bacillus competence pheromone ComX (ComX)

(1-42)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

52.83

94.643

0.5

Multiple sequence alignment