Detailed information NTG1100700

Bioinformatically predicted

Overview

• Name: comGD
• Type: Machinery gene
• Locus tag: ACM9DY_RS12890
• Genome accession: NZ_CP182170
• Coordinates: 2607363..2607800 (-)
• Length: 145 a.a.
• NCBI ID: WP_044053464.1
• Uniprot ID: -
• Organism: Bacillus velezensis strain F3
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2602363..2612800

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
ACM9DY_RS12840 (ACM9DY_12840)	sinI	2602748..2602921 (+)	174	WP_003153105.1	anti-repressor SinI	Regulator
ACM9DY_RS12845 (ACM9DY_12845)	sinR	2602955..2603290 (+)	336	WP_003153104.1	transcriptional regulator SinR	Regulator
ACM9DY_RS12850 (ACM9DY_12850)	tasA	2603338..2604123 (-)	786	WP_003153102.1	biofilm matrix protein TasA	-
ACM9DY_RS12855 (ACM9DY_12855)	sipW	2604187..2604771 (-)	585	WP_012117977.1	signal peptidase I SipW	-
ACM9DY_RS12860 (ACM9DY_12860)	tapA	2604743..2605414 (-)	672	WP_115996533.1	amyloid fiber anchoring/assembly protein TapA	-
ACM9DY_RS12865 (ACM9DY_12865)	-	2605673..2606002 (+)	330	WP_230639577.1	DUF3889 domain-containing protein	-
ACM9DY_RS12870 (ACM9DY_12870)	-	2606042..2606221 (-)	180	WP_003153093.1	YqzE family protein	-
ACM9DY_RS12875 (ACM9DY_12875)	comGG	2606278..2606655 (-)	378	WP_014305410.1	competence type IV pilus minor pilin ComGG	Machinery gene
ACM9DY_RS12880 (ACM9DY_12880)	comGF	2606656..2607051 (-)	396	WP_046559876.1	competence type IV pilus minor pilin ComGF	-
ACM9DY_RS12885 (ACM9DY_12885)	comGE	2607065..2607379 (-)	315	WP_015388003.1	competence type IV pilus minor pilin ComGE	Machinery gene
ACM9DY_RS12890 (ACM9DY_12890)	comGD	2607363..2607800 (-)	438	WP_044053464.1	competence type IV pilus minor pilin ComGD	Machinery gene
ACM9DY_RS12895 (ACM9DY_12895)	comGC	2607790..2608098 (-)	309	WP_003153087.1	competence type IV pilus major pilin ComGC	Machinery gene
ACM9DY_RS12900 (ACM9DY_12900)	comGB	2608103..2609140 (-)	1038	WP_024085602.1	competence type IV pilus assembly protein ComGB	Machinery gene
ACM9DY_RS12905 (ACM9DY_12905)	comGA	2609127..2610197 (-)	1071	WP_003153083.1	competence type IV pilus ATPase ComGA	Machinery gene
ACM9DY_RS12910 (ACM9DY_12910)	-	2610389..2611339 (-)	951	WP_014305415.1	magnesium transporter CorA family protein	-
ACM9DY_RS12915 (ACM9DY_12915)	-	2611485..2612786 (+)	1302	WP_230639578.1	hemolysin family protein	-

Sequence

Protein

• Length: 145 a.a.
• Molecular weight: 16282.81 Da
• Isoelectric Point: 10.3354

>NTDB_id=1100700 ACM9DY_RS12890 WP_044053464.1 2607363..2607800(-) (comGD) [Bacillus velezensis strain F3]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPVCTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIRLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide

• Length: 438 bp

>NTDB_id=1100700 ACM9DY_RS12890 WP_044053464.1 2607363..2607800(-) (comGD) [Bacillus velezensis strain F3]
TTGAACAATAACAGGCGGACAGAAAACGGGTTTACTCTTCTTGAAAGCCTGATTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGTCTGCACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTTCAAAAAGATA
TTCAGCTTGCGCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAGGCGGTAGGATTGTCGAGCGTTCTTTTGATTCGCTTCACATTACACTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATTCGATTGAAGAGCGCCGGGTTCACCTATGAGATCACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (5-31)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGD	Bacillus subtilis subsp. subtilis str. 168	56.164	100	0.566