Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | ACM9DY_RS12840 | Genome accession | NZ_CP182170 |
| Coordinates | 2602748..2602921 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain F3 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2597748..2607921
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACM9DY_RS12825 (ACM9DY_12825) | gcvT | 2598566..2599666 (-) | 1101 | WP_303302216.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| ACM9DY_RS12830 (ACM9DY_12830) | - | 2600089..2601759 (+) | 1671 | WP_003153107.1 | DEAD/DEAH box helicase | - |
| ACM9DY_RS12835 (ACM9DY_12835) | - | 2601777..2602571 (+) | 795 | WP_003153106.1 | YqhG family protein | - |
| ACM9DY_RS12840 (ACM9DY_12840) | sinI | 2602748..2602921 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| ACM9DY_RS12845 (ACM9DY_12845) | sinR | 2602955..2603290 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| ACM9DY_RS12850 (ACM9DY_12850) | tasA | 2603338..2604123 (-) | 786 | WP_003153102.1 | biofilm matrix protein TasA | - |
| ACM9DY_RS12855 (ACM9DY_12855) | sipW | 2604187..2604771 (-) | 585 | WP_012117977.1 | signal peptidase I SipW | - |
| ACM9DY_RS12860 (ACM9DY_12860) | tapA | 2604743..2605414 (-) | 672 | WP_115996533.1 | amyloid fiber anchoring/assembly protein TapA | - |
| ACM9DY_RS12865 (ACM9DY_12865) | - | 2605673..2606002 (+) | 330 | WP_230639577.1 | DUF3889 domain-containing protein | - |
| ACM9DY_RS12870 (ACM9DY_12870) | - | 2606042..2606221 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| ACM9DY_RS12875 (ACM9DY_12875) | comGG | 2606278..2606655 (-) | 378 | WP_014305410.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| ACM9DY_RS12880 (ACM9DY_12880) | comGF | 2606656..2607051 (-) | 396 | WP_046559876.1 | competence type IV pilus minor pilin ComGF | - |
| ACM9DY_RS12885 (ACM9DY_12885) | comGE | 2607065..2607379 (-) | 315 | WP_015388003.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| ACM9DY_RS12890 (ACM9DY_12890) | comGD | 2607363..2607800 (-) | 438 | WP_044053464.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=1100696 ACM9DY_RS12840 WP_003153105.1 2602748..2602921(+) (sinI) [Bacillus velezensis strain F3]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=1100696 ACM9DY_RS12840 WP_003153105.1 2602748..2602921(+) (sinI) [Bacillus velezensis strain F3]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |