Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   ACM9DY_RS12875 Genome accession   NZ_CP182170
Coordinates   2606278..2606655 (-) Length   125 a.a.
NCBI ID   WP_014305410.1    Uniprot ID   -
Organism   Bacillus velezensis strain F3     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2601278..2611655
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACM9DY_RS12835 (ACM9DY_12835) - 2601777..2602571 (+) 795 WP_003153106.1 YqhG family protein -
  ACM9DY_RS12840 (ACM9DY_12840) sinI 2602748..2602921 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  ACM9DY_RS12845 (ACM9DY_12845) sinR 2602955..2603290 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  ACM9DY_RS12850 (ACM9DY_12850) tasA 2603338..2604123 (-) 786 WP_003153102.1 biofilm matrix protein TasA -
  ACM9DY_RS12855 (ACM9DY_12855) sipW 2604187..2604771 (-) 585 WP_012117977.1 signal peptidase I SipW -
  ACM9DY_RS12860 (ACM9DY_12860) tapA 2604743..2605414 (-) 672 WP_115996533.1 amyloid fiber anchoring/assembly protein TapA -
  ACM9DY_RS12865 (ACM9DY_12865) - 2605673..2606002 (+) 330 WP_230639577.1 DUF3889 domain-containing protein -
  ACM9DY_RS12870 (ACM9DY_12870) - 2606042..2606221 (-) 180 WP_003153093.1 YqzE family protein -
  ACM9DY_RS12875 (ACM9DY_12875) comGG 2606278..2606655 (-) 378 WP_014305410.1 competence type IV pilus minor pilin ComGG Machinery gene
  ACM9DY_RS12880 (ACM9DY_12880) comGF 2606656..2607051 (-) 396 WP_046559876.1 competence type IV pilus minor pilin ComGF -
  ACM9DY_RS12885 (ACM9DY_12885) comGE 2607065..2607379 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  ACM9DY_RS12890 (ACM9DY_12890) comGD 2607363..2607800 (-) 438 WP_044053464.1 competence type IV pilus minor pilin ComGD Machinery gene
  ACM9DY_RS12895 (ACM9DY_12895) comGC 2607790..2608098 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  ACM9DY_RS12900 (ACM9DY_12900) comGB 2608103..2609140 (-) 1038 WP_024085602.1 competence type IV pilus assembly protein ComGB Machinery gene
  ACM9DY_RS12905 (ACM9DY_12905) comGA 2609127..2610197 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  ACM9DY_RS12910 (ACM9DY_12910) - 2610389..2611339 (-) 951 WP_014305415.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 125 a.a.        Molecular weight: 14170.14 Da        Isoelectric Point: 9.9592

>NTDB_id=1100698 ACM9DY_RS12875 WP_014305410.1 2606278..2606655(-) (comGG) [Bacillus velezensis strain F3]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKVQTGTQRFPYGTVS
FRITGSDRRETVQVTIQAETVSGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=1100698 ACM9DY_RS12875 WP_014305410.1 2606278..2606655(-) (comGG) [Bacillus velezensis strain F3]
ATGTACAAATCTGACGGTTTTATCTATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCGAAAGAGGCCGGGGAGTACTGGATCGGAGAGAATCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTACGGAACTGTTTCC
TTCCGCATCACCGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCCGAAACAGTGTCAGGCACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains


Predicted by InterProScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

51.613

99.2

0.512


Multiple sequence alignment