Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   ACM6AB_RS10445 Genome accession   NZ_CP181140
Coordinates   2091008..2091478 (-) Length   156 a.a.
NCBI ID   WP_000934759.1    Uniprot ID   A0A2I7Y8V1
Organism   Staphylococcus aureus strain AG21-0599     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2062027..2115546 2091008..2091478 within 0


Gene organization within MGE regions


Location: 2062027..2115546
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACM6AB_RS10235 (ACM6AB_10235) scn 2062027..2062377 (-) 351 WP_000702263.1 complement inhibitor SCIN-A -
  ACM6AB_RS10240 (ACM6AB_10240) - 2063062..2063511 (+) 450 WP_000727649.1 chemotaxis-inhibiting protein CHIPS -
  ACM6AB_RS10245 (ACM6AB_10245) - 2063606..2063944 (-) 339 Protein_1983 SH3 domain-containing protein -
  ACM6AB_RS10250 (ACM6AB_10250) sak 2064591..2065082 (-) 492 WP_000919350.1 staphylokinase -
  ACM6AB_RS10255 (ACM6AB_10255) - 2065273..2066028 (-) 756 WP_000861038.1 CHAP domain-containing protein -
  ACM6AB_RS10260 (ACM6AB_10260) - 2066040..2066294 (-) 255 WP_000611512.1 phage holin -
  ACM6AB_RS10265 (ACM6AB_10265) - 2066346..2066453 (+) 108 WP_001791821.1 hypothetical protein -
  ACM6AB_RS10270 (ACM6AB_10270) pepG1 2066506..2066640 (-) 135 WP_000226108.1 type I toxin-antitoxin system toxin PepG1 -
  ACM6AB_RS10275 (ACM6AB_10275) - 2066832..2067128 (-) 297 WP_000539688.1 DUF2951 domain-containing protein -
  ACM6AB_RS10280 (ACM6AB_10280) - 2067186..2067473 (-) 288 WP_001040261.1 hypothetical protein -
  ACM6AB_RS10285 (ACM6AB_10285) - 2067520..2067672 (-) 153 WP_001153681.1 hypothetical protein -
  ACM6AB_RS10290 (ACM6AB_10290) - 2067662..2071447 (-) 3786 WP_000582154.1 phage tail spike protein -
  ACM6AB_RS10295 (ACM6AB_10295) - 2071463..2072947 (-) 1485 WP_000567396.1 phage distal tail protein -
  ACM6AB_RS10300 (ACM6AB_10300) - 2072944..2077476 (-) 4533 WP_001557459.1 phage tail tape measure protein -
  ACM6AB_RS10305 (ACM6AB_10305) gpGT 2077533..2077670 (-) 138 WP_001549167.1 phage tail assembly chaperone GT -
  ACM6AB_RS10310 (ACM6AB_10310) gpG 2077721..2078071 (-) 351 WP_001096355.1 phage tail assembly chaperone G -
  ACM6AB_RS10315 (ACM6AB_10315) - 2078121..2078351 (-) 231 Protein_1997 Ig-like domain-containing protein -
  ACM6AB_RS10320 (ACM6AB_10320) - 2078387..2079031 (-) 645 WP_000985142.1 major tail protein -
  ACM6AB_RS10325 (ACM6AB_10325) - 2079032..2079439 (-) 408 WP_000565498.1 hypothetical protein -
  ACM6AB_RS10330 (ACM6AB_10330) - 2079436..2079840 (-) 405 WP_000114341.1 HK97 gp10 family phage protein -
  ACM6AB_RS10335 (ACM6AB_10335) - 2079837..2080199 (-) 363 WP_000755150.1 head-tail adaptor protein -
  ACM6AB_RS10340 (ACM6AB_10340) - 2080183..2080467 (-) 285 WP_000150936.1 phage head-tail adapter protein -
  ACM6AB_RS10345 (ACM6AB_10345) - 2080457..2080741 (-) 285 WP_000238241.1 hypothetical protein -
  ACM6AB_RS10350 (ACM6AB_10350) - 2080761..2081906 (-) 1146 WP_000154568.1 phage major capsid protein -
  ACM6AB_RS10355 (ACM6AB_10355) - 2081929..2082666 (-) 738 WP_000861911.1 head maturation protease, ClpP-related -
  ACM6AB_RS10360 (ACM6AB_10360) - 2082650..2083813 (-) 1164 WP_000025268.1 phage portal protein -
  ACM6AB_RS10365 (ACM6AB_10365) - 2083829..2085490 (-) 1662 WP_000625096.1 terminase large subunit -
  ACM6AB_RS10370 (ACM6AB_10370) - 2085487..2085831 (-) 345 WP_000402904.1 hypothetical protein -
  ACM6AB_RS10375 (ACM6AB_10375) - 2085962..2086261 (-) 300 WP_000988332.1 HNH endonuclease -
  ACM6AB_RS10380 (ACM6AB_10380) - 2086493..2086909 (-) 417 WP_000590122.1 hypothetical protein -
  ACM6AB_RS10385 (ACM6AB_10385) - 2086937..2087137 (-) 201 WP_001557462.1 DUF1514 family protein -
  ACM6AB_RS10390 (ACM6AB_10390) rinB 2087137..2087286 (-) 150 WP_000595265.1 transcriptional activator RinB -
  ACM6AB_RS10395 (ACM6AB_10395) - 2087283..2087489 (-) 207 WP_000195784.1 DUF1381 domain-containing protein -
  ACM6AB_RS10400 (ACM6AB_10400) - 2087486..2087731 (-) 246 WP_001282077.1 hypothetical protein -
  ACM6AB_RS10405 (ACM6AB_10405) - 2087768..2088304 (-) 537 WP_000185693.1 dUTPase -
  ACM6AB_RS10410 (ACM6AB_10410) - 2088301..2088546 (-) 246 WP_001065108.1 DUF1024 family protein -
  ACM6AB_RS10415 (ACM6AB_10415) - 2088561..2088803 (-) 243 WP_000221877.1 SAV1978 family virulence-associated passenger protein -
  ACM6AB_RS10420 (ACM6AB_10420) - 2088806..2089063 (-) 258 WP_000111491.1 DUF3310 domain-containing protein -
  ACM6AB_RS10425 (ACM6AB_10425) - 2089063..2089434 (-) 372 WP_000101279.1 SA1788 family PVL leukocidin-associated protein -
  ACM6AB_RS10430 (ACM6AB_10430) - 2089447..2089851 (-) 405 WP_000401969.1 RusA family crossover junction endodeoxyribonuclease -
  ACM6AB_RS10435 (ACM6AB_10435) - 2089860..2090078 (-) 219 WP_000338528.1 hypothetical protein -
  ACM6AB_RS10440 (ACM6AB_10440) - 2090085..2090978 (-) 894 WP_000148333.1 DnaD domain protein -
  ACM6AB_RS10445 (ACM6AB_10445) ssbA 2091008..2091478 (-) 471 WP_000934759.1 single-stranded DNA-binding protein Machinery gene
  ACM6AB_RS10450 (ACM6AB_10450) - 2091479..2092096 (-) 618 WP_064135358.1 MBL fold metallo-hydrolase -
  ACM6AB_RS10455 (ACM6AB_10455) - 2092177..2093097 (-) 921 WP_000180600.1 recombinase RecT -
  ACM6AB_RS10460 (ACM6AB_10460) - 2093099..2095042 (-) 1944 WP_000700554.1 AAA family ATPase -
  ACM6AB_RS10465 (ACM6AB_10465) - 2095051..2095314 (-) 264 WP_001205732.1 hypothetical protein -
  ACM6AB_RS10470 (ACM6AB_10470) - 2095323..2095583 (-) 261 WP_000291510.1 DUF1108 family protein -
  ACM6AB_RS10475 (ACM6AB_10475) - 2095588..2095890 (-) 303 WP_000165371.1 DUF2482 family protein -
  ACM6AB_RS10480 (ACM6AB_10480) - 2095985..2096146 (-) 162 WP_000048129.1 DUF1270 family protein -
  ACM6AB_RS10485 (ACM6AB_10485) - 2096143..2096466 (-) 324 WP_001120201.1 DUF771 domain-containing protein -
  ACM6AB_RS10490 (ACM6AB_10490) - 2096521..2096901 (+) 381 WP_000762521.1 DUF2513 domain-containing protein -
  ACM6AB_RS10495 (ACM6AB_10495) - 2096888..2097085 (-) 198 WP_001148862.1 hypothetical protein -
  ACM6AB_RS10500 (ACM6AB_10500) - 2097101..2097850 (-) 750 WP_001148338.1 phage antirepressor KilAC domain-containing protein -
  ACM6AB_RS10505 (ACM6AB_10505) - 2097907..2098116 (+) 210 WP_000772137.1 hypothetical protein -
  ACM6AB_RS10510 (ACM6AB_10510) - 2098109..2098249 (-) 141 WP_000939495.1 hypothetical protein -
  ACM6AB_RS10515 (ACM6AB_10515) - 2098264..2098707 (-) 444 WP_000435360.1 hypothetical protein -
  ACM6AB_RS10520 (ACM6AB_10520) - 2098720..2098962 (-) 243 WP_000639923.1 DUF739 family protein -
  ACM6AB_RS10525 (ACM6AB_10525) - 2099126..2099842 (+) 717 WP_001083975.1 LexA family transcriptional regulator -
  ACM6AB_RS10530 (ACM6AB_10530) - 2099854..2100708 (+) 855 WP_001557601.1 HIRAN domain-containing protein -
  ACM6AB_RS10535 (ACM6AB_10535) - 2100782..2100928 (+) 147 WP_000345949.1 hypothetical protein -
  ACM6AB_RS10540 (ACM6AB_10540) - 2100925..2101110 (+) 186 WP_000109189.1 hypothetical protein -
  ACM6AB_RS10545 (ACM6AB_10545) - 2101181..2101363 (+) 183 WP_000705245.1 hypothetical protein -
  ACM6AB_RS10550 (ACM6AB_10550) - 2101442..2102155 (+) 714 WP_001549185.1 type II toxin-antitoxin system PemK/MazF family toxin -
  ACM6AB_RS10555 (ACM6AB_10555) - 2102346..2103383 (+) 1038 WP_000857200.1 tyrosine-type recombinase/integrase -
  ACM6AB_RS10560 (ACM6AB_10560) sph 2103440..2104264 (+) 825 Protein_2046 sphingomyelin phosphodiesterase -
  ACM6AB_RS10565 (ACM6AB_10565) lukG 2104502..2105518 (-) 1017 WP_000595392.1 bi-component leukocidin LukGH subunit G -
  ACM6AB_RS10570 (ACM6AB_10570) lukH 2105540..2106595 (-) 1056 WP_000791411.1 bi-component leukocidin LukGH subunit H -
  ACM6AB_RS10575 (ACM6AB_10575) - 2107031..2108254 (+) 1224 WP_000206625.1 ArgE/DapE family deacylase -
  ACM6AB_RS10580 (ACM6AB_10580) - 2108698..2110005 (+) 1308 WP_001045079.1 TrkH family potassium uptake protein -
  ACM6AB_RS10585 (ACM6AB_10585) groL 2110545..2112161 (-) 1617 WP_000240642.1 chaperonin GroEL -
  ACM6AB_RS10590 (ACM6AB_10590) groES 2112237..2112521 (-) 285 WP_000917289.1 co-chaperone GroES -
  ACM6AB_RS10595 (ACM6AB_10595) mroQ 2112696..2113439 (+) 744 WP_000197635.1 CPBP family intramembrane glutamic endopeptidase MroQ -
  ACM6AB_RS10600 (ACM6AB_10600) - 2113464..2114723 (-) 1260 WP_000120297.1 SdrH family protein -
  ACM6AB_RS10605 (ACM6AB_10605) - 2114920..2115546 (+) 627 WP_000522381.1 nitroreductase family protein -

Sequence


Protein


Download         Length: 156 a.a.        Molecular weight: 17641.52 Da        Isoelectric Point: 5.2672

>NTDB_id=1098970 ACM6AB_RS10445 WP_000934759.1 2091008..2091478(-) (ssbA) [Staphylococcus aureus strain AG21-0599]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDNDLPF

Nucleotide


Download         Length: 471 bp        

>NTDB_id=1098970 ACM6AB_RS10445 WP_000934759.1 2091008..2091478(-) (ssbA) [Staphylococcus aureus strain AG21-0599]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A2I7Y8V1

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

55.932

100

0.635

  ssb Latilactobacillus sakei subsp. sakei 23K

50.588

100

0.551

  ssbB Bacillus subtilis subsp. subtilis str. 168

59.434

67.949

0.404

  ssb Glaesserella parasuis strain SC1401

32.203

100

0.365


Multiple sequence alignment