Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   ACM6AB_RS05560 Genome accession   NZ_CP181140
Coordinates   1127369..1127839 (+) Length   156 a.a.
NCBI ID   WP_000934759.1    Uniprot ID   A0A2I7Y8V1
Organism   Staphylococcus aureus strain AG21-0599     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1117958..1161642 1127369..1127839 within 0


Gene organization within MGE regions


Location: 1117958..1161642
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACM6AB_RS05475 (ACM6AB_05475) - 1117958..1119343 (-) 1386 WP_416152936.1 recombinase family protein -
  ACM6AB_RS05480 (ACM6AB_05480) - 1119550..1119672 (-) 123 WP_001077637.1 hypothetical protein -
  ACM6AB_RS05485 (ACM6AB_05485) - 1119693..1120154 (-) 462 WP_000525016.1 hypothetical protein -
  ACM6AB_RS05490 (ACM6AB_05490) - 1120167..1120490 (-) 324 WP_001260487.1 helix-turn-helix domain-containing protein -
  ACM6AB_RS05495 (ACM6AB_05495) - 1120654..1120902 (+) 249 WP_000272858.1 helix-turn-helix domain-containing protein -
  ACM6AB_RS05500 (ACM6AB_05500) - 1120917..1121078 (+) 162 WP_001153175.1 hypothetical protein -
  ACM6AB_RS05505 (ACM6AB_05505) - 1121071..1121307 (-) 237 WP_000856472.1 hypothetical protein -
  ACM6AB_RS05510 (ACM6AB_05510) - 1121372..1122115 (+) 744 WP_001148623.1 phage antirepressor KilAC domain-containing protein -
  ACM6AB_RS05515 (ACM6AB_05515) - 1122291..1122521 (-) 231 WP_000395455.1 hypothetical protein -
  ACM6AB_RS05520 (ACM6AB_05520) - 1122580..1122708 (+) 129 WP_001559112.1 hypothetical protein -
  ACM6AB_RS05525 (ACM6AB_05525) - 1122701..1122862 (+) 162 WP_000048129.1 DUF1270 family protein -
  ACM6AB_RS05530 (ACM6AB_05530) - 1122957..1123259 (+) 303 WP_000165371.1 DUF2482 family protein -
  ACM6AB_RS05535 (ACM6AB_05535) - 1123264..1123524 (+) 261 WP_000291510.1 DUF1108 family protein -
  ACM6AB_RS05540 (ACM6AB_05540) - 1123533..1123796 (+) 264 WP_001205732.1 hypothetical protein -
  ACM6AB_RS05545 (ACM6AB_05545) - 1123805..1125748 (+) 1944 WP_000700554.1 AAA family ATPase -
  ACM6AB_RS05550 (ACM6AB_05550) - 1125750..1126670 (+) 921 WP_000180600.1 recombinase RecT -
  ACM6AB_RS05555 (ACM6AB_05555) - 1126751..1127368 (+) 618 WP_064135358.1 MBL fold metallo-hydrolase -
  ACM6AB_RS05560 (ACM6AB_05560) ssbA 1127369..1127839 (+) 471 WP_000934759.1 single-stranded DNA-binding protein Machinery gene
  ACM6AB_RS05565 (ACM6AB_05565) - 1127869..1128762 (+) 894 WP_000148333.1 DnaD domain protein -
  ACM6AB_RS05570 (ACM6AB_05570) - 1128769..1128987 (+) 219 WP_000338528.1 hypothetical protein -
  ACM6AB_RS05575 (ACM6AB_05575) - 1128996..1129400 (+) 405 WP_000401969.1 RusA family crossover junction endodeoxyribonuclease -
  ACM6AB_RS05580 (ACM6AB_05580) - 1129413..1129781 (+) 369 WP_000101274.1 SA1788 family PVL leukocidin-associated protein -
  ACM6AB_RS05585 (ACM6AB_05585) - 1129785..1130027 (+) 243 WP_000131363.1 SAV1978 family virulence-associated passenger protein -
  ACM6AB_RS05590 (ACM6AB_05590) - 1130042..1130248 (+) 207 WP_000693989.1 hypothetical protein -
  ACM6AB_RS05595 (ACM6AB_05595) - 1130251..1130652 (+) 402 WP_000695757.1 hypothetical protein -
  ACM6AB_RS05600 (ACM6AB_05600) - 1130649..1130996 (+) 348 WP_000979209.1 YopX family protein -
  ACM6AB_RS05605 (ACM6AB_05605) - 1130993..1131301 (+) 309 WP_000144711.1 hypothetical protein -
  ACM6AB_RS05610 (ACM6AB_05610) - 1131294..1131529 (+) 236 Protein_1098 DUF1024 family protein -
  ACM6AB_RS05615 (ACM6AB_05615) - 1131534..1132064 (+) 531 WP_031807946.1 dUTP diphosphatase -
  ACM6AB_RS05620 (ACM6AB_05620) - 1132101..1132307 (+) 207 WP_000195835.1 DUF1381 domain-containing protein -
  ACM6AB_RS05625 (ACM6AB_05625) - 1132304..1132690 (+) 387 WP_000592205.1 hypothetical protein -
  ACM6AB_RS05630 (ACM6AB_05630) rinB 1132687..1132860 (+) 174 WP_000595235.1 transcriptional activator RinB -
  ACM6AB_RS05635 (ACM6AB_05635) - 1132861..1133226 (+) 366 WP_000989954.1 hypothetical protein -
  ACM6AB_RS05640 (ACM6AB_05640) - 1133227..1133373 (+) 147 WP_000989960.1 hypothetical protein -
  ACM6AB_RS05645 (ACM6AB_05645) - 1133397..1133819 (+) 423 WP_000162696.1 RinA family phage transcriptional activator -
  ACM6AB_RS05650 (ACM6AB_05650) - 1134006..1134446 (+) 441 WP_001003271.1 terminase small subunit -
  ACM6AB_RS05655 (ACM6AB_05655) - 1134433..1135710 (+) 1278 WP_000169946.1 PBSX family phage terminase large subunit -
  ACM6AB_RS05660 (ACM6AB_05660) - 1135721..1137259 (+) 1539 WP_000909977.1 phage portal protein -
  ACM6AB_RS05665 (ACM6AB_05665) - 1137266..1138261 (+) 996 WP_001133044.1 minor capsid protein -
  ACM6AB_RS05670 (ACM6AB_05670) - 1138334..1138504 (+) 171 WP_000072208.1 hypothetical protein -
  ACM6AB_RS05675 (ACM6AB_05675) - 1138532..1138619 (+) 88 Protein_1111 hypothetical protein -
  ACM6AB_RS05680 (ACM6AB_05680) - 1138613..1139233 (+) 621 WP_000392151.1 DUF4355 domain-containing protein -
  ACM6AB_RS05685 (ACM6AB_05685) - 1139247..1140221 (+) 975 WP_015977968.1 phage major capsid protein -
  ACM6AB_RS05690 (ACM6AB_05690) - 1140243..1140530 (+) 288 WP_001114086.1 hypothetical protein -
  ACM6AB_RS05695 (ACM6AB_05695) - 1140539..1140871 (+) 333 WP_416152937.1 phage head-tail connector protein -
  ACM6AB_RS05700 (ACM6AB_05700) - 1140868..1141170 (+) 303 WP_001268312.1 hypothetical protein -
  ACM6AB_RS05705 (ACM6AB_05705) - 1141170..1141517 (+) 348 WP_001017815.1 HK97-gp10 family putative phage morphogenesis protein -
  ACM6AB_RS05710 (ACM6AB_05710) - 1141529..1141912 (+) 384 WP_000188643.1 hypothetical protein -
  ACM6AB_RS05715 (ACM6AB_05715) - 1141931..1142512 (+) 582 WP_000002577.1 phage major tail protein, TP901-1 family -
  ACM6AB_RS05720 (ACM6AB_05720) - 1142574..1142939 (+) 366 WP_001100161.1 tail assembly chaperone -
  ACM6AB_RS05725 (ACM6AB_05725) - 1142969..1143313 (+) 345 WP_000105584.1 hypothetical protein -
  ACM6AB_RS05730 (ACM6AB_05730) - 1143330..1146794 (+) 3465 WP_416152938.1 hypothetical protein -
  ACM6AB_RS05735 (ACM6AB_05735) - 1146807..1147754 (+) 948 WP_000350675.1 phage tail family protein -
  ACM6AB_RS05740 (ACM6AB_05740) - 1147763..1149664 (+) 1902 WP_000152714.1 SGNH/GDSL hydrolase family protein -
  ACM6AB_RS05745 (ACM6AB_05745) - 1149679..1151589 (+) 1911 WP_000369017.1 hypothetical protein -
  ACM6AB_RS05750 (ACM6AB_05750) - 1151589..1153412 (+) 1824 WP_000259619.1 phage baseplate upper protein -
  ACM6AB_RS05755 (ACM6AB_05755) - 1153412..1153789 (+) 378 WP_000705910.1 DUF2977 domain-containing protein -
  ACM6AB_RS05760 (ACM6AB_05760) - 1153799..1153972 (+) 174 WP_015990323.1 XkdX family protein -
  ACM6AB_RS05765 (ACM6AB_05765) - 1154013..1154312 (+) 300 WP_000466778.1 DUF2951 domain-containing protein -
  ACM6AB_RS05770 (ACM6AB_05770) - 1154449..1156347 (+) 1899 WP_001628105.1 glucosaminidase domain-containing protein -
  ACM6AB_RS05775 (ACM6AB_05775) - 1156360..1157598 (+) 1239 WP_001624558.1 BppU family phage baseplate upper protein -
  ACM6AB_RS05780 (ACM6AB_05780) - 1157604..1157999 (+) 396 WP_000398878.1 hypothetical protein -
  ACM6AB_RS05785 (ACM6AB_05785) - 1158055..1158492 (+) 438 WP_000354132.1 phage holin -
  ACM6AB_RS05790 (ACM6AB_05790) - 1158473..1159918 (+) 1446 WP_001148130.1 SH3 domain-containing protein -
  ACM6AB_RS05795 (ACM6AB_05795) - 1160324..1160986 (+) 663 WP_000385047.1 hypothetical protein -
  ACM6AB_RS05800 (ACM6AB_05800) - 1161001..1161642 (+) 642 WP_001190816.1 hypothetical protein -

Sequence


Protein


Download         Length: 156 a.a.        Molecular weight: 17641.52 Da        Isoelectric Point: 5.2672

>NTDB_id=1098948 ACM6AB_RS05560 WP_000934759.1 1127369..1127839(+) (ssbA) [Staphylococcus aureus strain AG21-0599]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDNDLPF

Nucleotide


Download         Length: 471 bp        

>NTDB_id=1098948 ACM6AB_RS05560 WP_000934759.1 1127369..1127839(+) (ssbA) [Staphylococcus aureus strain AG21-0599]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A2I7Y8V1

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

55.932

100

0.635

  ssb Latilactobacillus sakei subsp. sakei 23K

50.588

100

0.551

  ssbB Bacillus subtilis subsp. subtilis str. 168

59.434

67.949

0.404

  ssb Glaesserella parasuis strain SC1401

32.203

100

0.365


Multiple sequence alignment