Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | ACM2KS_RS14245 | Genome accession | NZ_CP181087 |
| Coordinates | 3051305..3051835 (+) | Length | 176 a.a. |
| NCBI ID | WP_060558092.1 | Uniprot ID | - |
| Organism | Proteus mirabilis strain SH-8 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 3008288..3057884 | 3051305..3051835 | within | 0 |
Gene organization within MGE regions
Location: 3008288..3057884
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACM2KS_RS13930 (ACM2KS_13930) | - | 3008288..3008506 (+) | 219 | WP_060556896.1 | DNA polymerase III subunit theta | - |
| ACM2KS_RS13935 (ACM2KS_13935) | - | 3008613..3008975 (+) | 363 | WP_060556897.1 | GtrA family protein | - |
| ACM2KS_RS13940 (ACM2KS_13940) | - | 3008975..3009892 (+) | 918 | WP_060556898.1 | glycosyltransferase family 2 protein | - |
| ACM2KS_RS13945 (ACM2KS_13945) | - | 3009892..3011346 (+) | 1455 | WP_416145830.1 | glucosyltransferase domain-containing protein | - |
| ACM2KS_RS13950 (ACM2KS_13950) | - | 3011403..3012173 (-) | 771 | WP_124725225.1 | hypothetical protein | - |
| ACM2KS_RS13955 (ACM2KS_13955) | - | 3012185..3013429 (-) | 1245 | WP_124725226.1 | glycerophosphodiester phosphodiesterase family protein | - |
| ACM2KS_RS13960 (ACM2KS_13960) | - | 3013487..3015955 (-) | 2469 | WP_060556902.1 | host specificity factor TipJ family phage tail protein | - |
| ACM2KS_RS13965 (ACM2KS_13965) | - | 3015942..3016334 (-) | 393 | WP_060556903.1 | NlpC/P60 family protein | - |
| ACM2KS_RS13970 (ACM2KS_13970) | - | 3016331..3016801 (-) | 471 | WP_060556904.1 | DUF1833 family protein | - |
| ACM2KS_RS13975 (ACM2KS_13975) | - | 3016801..3017277 (-) | 477 | WP_060556905.1 | hypothetical protein | - |
| ACM2KS_RS13980 (ACM2KS_13980) | - | 3017281..3020457 (-) | 3177 | WP_155195932.1 | hypothetical protein | - |
| ACM2KS_RS13985 (ACM2KS_13985) | - | 3020525..3021247 (-) | 723 | WP_060556273.1 | hypothetical protein | - |
| ACM2KS_RS13990 (ACM2KS_13990) | - | 3021370..3022245 (-) | 876 | WP_241681736.1 | Rha family transcriptional regulator | - |
| ACM2KS_RS13995 (ACM2KS_13995) | - | 3022242..3022811 (-) | 570 | WP_241681737.1 | Bro-N domain-containing protein | - |
| ACM2KS_RS14000 (ACM2KS_14000) | - | 3022881..3023051 (-) | 171 | WP_155195934.1 | hypothetical protein | - |
| ACM2KS_RS14005 (ACM2KS_14005) | - | 3023149..3023472 (+) | 324 | WP_172767708.1 | Arc family DNA-binding protein | - |
| ACM2KS_RS14010 (ACM2KS_14010) | - | 3023545..3024237 (-) | 693 | WP_060556627.1 | DUF6246 family protein | - |
| ACM2KS_RS14015 (ACM2KS_14015) | - | 3024287..3025042 (-) | 756 | WP_060556626.1 | Ig-like domain-containing protein | - |
| ACM2KS_RS14020 (ACM2KS_14020) | - | 3025116..3025484 (-) | 369 | WP_060556625.1 | hypothetical protein | - |
| ACM2KS_RS14025 (ACM2KS_14025) | - | 3025481..3025849 (-) | 369 | WP_049257616.1 | hypothetical protein | - |
| ACM2KS_RS14030 (ACM2KS_14030) | - | 3025851..3026189 (-) | 339 | WP_060556624.1 | hypothetical protein | - |
| ACM2KS_RS14035 (ACM2KS_14035) | - | 3026189..3026587 (-) | 399 | WP_060556623.1 | hypothetical protein | - |
| ACM2KS_RS14040 (ACM2KS_14040) | - | 3026644..3026817 (-) | 174 | WP_060556622.1 | hypothetical protein | - |
| ACM2KS_RS14045 (ACM2KS_14045) | - | 3026827..3027921 (-) | 1095 | WP_060556621.1 | major capsid protein | - |
| ACM2KS_RS14050 (ACM2KS_14050) | - | 3027934..3028383 (-) | 450 | WP_060556620.1 | hypothetical protein | - |
| ACM2KS_RS14055 (ACM2KS_14055) | - | 3028383..3029657 (-) | 1275 | WP_060556619.1 | hypothetical protein | - |
| ACM2KS_RS14060 (ACM2KS_14060) | - | 3029661..3030590 (-) | 930 | WP_060556618.1 | phage minor head protein | - |
| ACM2KS_RS14065 (ACM2KS_14065) | - | 3030541..3031896 (-) | 1356 | WP_060556617.1 | anti-CBASS protein Acb1 family protein | - |
| ACM2KS_RS14070 (ACM2KS_14070) | - | 3031896..3033146 (-) | 1251 | WP_416145831.1 | PBSX family phage terminase large subunit | - |
| ACM2KS_RS14075 (ACM2KS_14075) | - | 3033130..3033555 (-) | 426 | WP_060556615.1 | DNA-packaging protein | - |
| ACM2KS_RS14080 (ACM2KS_14080) | - | 3033572..3033781 (-) | 210 | WP_373371018.1 | hypothetical protein | - |
| ACM2KS_RS14085 (ACM2KS_14085) | - | 3033788..3034147 (-) | 360 | WP_036905461.1 | hypothetical protein | - |
| ACM2KS_RS14090 (ACM2KS_14090) | - | 3034128..3034892 (-) | 765 | WP_241681738.1 | KilA-N domain-containing protein | - |
| ACM2KS_RS14095 (ACM2KS_14095) | - | 3035489..3035890 (-) | 402 | WP_060556604.1 | hypothetical protein | - |
| ACM2KS_RS14100 (ACM2KS_14100) | - | 3035887..3036291 (-) | 405 | WP_060556605.1 | structural protein | - |
| ACM2KS_RS14105 (ACM2KS_14105) | - | 3036284..3036571 (-) | 288 | WP_036970165.1 | phage holin family protein | - |
| ACM2KS_RS14110 (ACM2KS_14110) | - | 3036568..3036957 (-) | 390 | WP_004916901.1 | putative holin | - |
| ACM2KS_RS14115 (ACM2KS_14115) | - | 3037092..3037859 (-) | 768 | WP_416145832.1 | KilA-N domain-containing protein | - |
| ACM2KS_RS14120 (ACM2KS_14120) | - | 3038336..3039175 (-) | 840 | WP_060556907.1 | antitermination protein | - |
| ACM2KS_RS14125 (ACM2KS_14125) | - | 3039172..3039372 (-) | 201 | WP_060556908.1 | NinH | - |
| ACM2KS_RS14130 (ACM2KS_14130) | - | 3039362..3039955 (-) | 594 | WP_060556909.1 | recombination protein NinG | - |
| ACM2KS_RS14135 (ACM2KS_14135) | - | 3039927..3040061 (-) | 135 | WP_277756772.1 | hypothetical protein | - |
| ACM2KS_RS14140 (ACM2KS_14140) | - | 3040067..3040291 (-) | 225 | WP_060556914.1 | DUF3310 domain-containing protein | - |
| ACM2KS_RS14145 (ACM2KS_14145) | - | 3040297..3040743 (-) | 447 | WP_155195940.1 | recombination protein NinB | - |
| ACM2KS_RS14150 (ACM2KS_14150) | - | 3041154..3041381 (-) | 228 | WP_131728024.1 | hypothetical protein | - |
| ACM2KS_RS14155 (ACM2KS_14155) | - | 3041378..3041602 (-) | 225 | WP_060556611.1 | DUF551 domain-containing protein | - |
| ACM2KS_RS14160 (ACM2KS_14160) | - | 3041653..3041820 (-) | 168 | WP_152964332.1 | hypothetical protein | - |
| ACM2KS_RS14165 (ACM2KS_14165) | rdgC | 3041840..3042751 (-) | 912 | WP_060556819.1 | recombination-associated protein RdgC | - |
| ACM2KS_RS14170 (ACM2KS_14170) | - | 3042762..3043448 (-) | 687 | WP_060556820.1 | replication protein P | - |
| ACM2KS_RS14175 (ACM2KS_14175) | - | 3043445..3044383 (-) | 939 | WP_060556821.1 | replication protein | - |
| ACM2KS_RS14180 (ACM2KS_14180) | - | 3044380..3045075 (-) | 696 | WP_060556822.1 | phage antirepressor KilAC domain-containing protein | - |
| ACM2KS_RS14185 (ACM2KS_14185) | - | 3045097..3045429 (-) | 333 | WP_060556823.1 | CII family transcriptional regulator | - |
| ACM2KS_RS14190 (ACM2KS_14190) | - | 3045565..3045750 (-) | 186 | WP_036895075.1 | Cro/CI family transcriptional regulator | - |
| ACM2KS_RS14195 (ACM2KS_14195) | - | 3045846..3046556 (+) | 711 | WP_060556824.1 | LexA family protein | - |
| ACM2KS_RS14200 (ACM2KS_14200) | - | 3046710..3047120 (+) | 411 | WP_060556825.1 | hypothetical protein | - |
| ACM2KS_RS14205 (ACM2KS_14205) | - | 3047494..3047766 (+) | 273 | WP_115370313.1 | hypothetical protein | - |
| ACM2KS_RS14210 (ACM2KS_14210) | - | 3047788..3048285 (-) | 498 | WP_060557708.1 | YjcQ family protein | - |
| ACM2KS_RS14215 (ACM2KS_14215) | - | 3048485..3049054 (+) | 570 | WP_060557707.1 | hypothetical protein | - |
| ACM2KS_RS14220 (ACM2KS_14220) | - | 3049275..3049550 (+) | 276 | WP_058336156.1 | hypothetical protein | - |
| ACM2KS_RS14225 (ACM2KS_14225) | - | 3049547..3049699 (+) | 153 | WP_175212394.1 | hypothetical protein | - |
| ACM2KS_RS14230 (ACM2KS_14230) | - | 3049696..3050016 (+) | 321 | WP_060558097.1 | hypothetical protein | - |
| ACM2KS_RS14235 (ACM2KS_14235) | exoX | 3050018..3050695 (+) | 678 | WP_060558095.1 | exodeoxyribonuclease X | - |
| ACM2KS_RS14240 (ACM2KS_14240) | - | 3050688..3051305 (+) | 618 | WP_060558093.1 | ERF family protein | - |
| ACM2KS_RS14245 (ACM2KS_14245) | ssb | 3051305..3051835 (+) | 531 | WP_060558092.1 | single-stranded DNA-binding protein | Machinery gene |
| ACM2KS_RS14250 (ACM2KS_14250) | - | 3051886..3052104 (+) | 219 | WP_049210558.1 | hypothetical protein | - |
| ACM2KS_RS14255 (ACM2KS_14255) | - | 3052135..3052422 (+) | 288 | WP_060558090.1 | cyclic-phosphate processing receiver domain-containing protein | - |
| ACM2KS_RS14260 (ACM2KS_14260) | - | 3052422..3052691 (+) | 270 | WP_060558088.1 | hypothetical protein | - |
| ACM2KS_RS14265 (ACM2KS_14265) | - | 3052684..3052929 (+) | 246 | WP_049211072.1 | hypothetical protein | - |
| ACM2KS_RS14270 (ACM2KS_14270) | - | 3053088..3053453 (+) | 366 | WP_060558087.1 | DUF2528 family protein | - |
| ACM2KS_RS14275 (ACM2KS_14275) | - | 3053457..3053684 (+) | 228 | WP_060558086.1 | hypothetical protein | - |
| ACM2KS_RS14280 (ACM2KS_14280) | - | 3053671..3054273 (+) | 603 | WP_060558085.1 | MT-A70 family methyltransferase | - |
| ACM2KS_RS14285 (ACM2KS_14285) | - | 3054709..3055866 (+) | 1158 | WP_416145833.1 | tyrosine-type recombinase/integrase | - |
| ACM2KS_RS14295 (ACM2KS_14295) | folD | 3056156..3057028 (+) | 873 | WP_060554830.1 | bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD | - |
| ACM2KS_RS14300 (ACM2KS_14300) | ybcJ | 3057032..3057244 (+) | 213 | WP_060556405.1 | ribosome-associated protein YbcJ | - |
Sequence
Protein
Download Length: 176 a.a. Molecular weight: 19540.05 Da Isoelectric Point: 7.2416
>NTDB_id=1098115 ACM2KS_RS14245 WP_060558092.1 3051305..3051835(+) (ssb) [Proteus mirabilis strain SH-8]
MASKGVNKCILIGHLGQDPEIRYMPSGGAVANLTLATSESWRDKQTGEMKEKTEWHRVCIFGKLAEIAGEYLRKGSQVYI
EGSLQTRKWQDQSGQDRYTTEVVVNIGGTMQMLGGNQAGSQKPQQNQGWGQPQAPKAPQQQPKQQTPQSEPPMDFDDDIP
FAPIGLPYPRHAIYVI
MASKGVNKCILIGHLGQDPEIRYMPSGGAVANLTLATSESWRDKQTGEMKEKTEWHRVCIFGKLAEIAGEYLRKGSQVYI
EGSLQTRKWQDQSGQDRYTTEVVVNIGGTMQMLGGNQAGSQKPQQNQGWGQPQAPKAPQQQPKQQTPQSEPPMDFDDDIP
FAPIGLPYPRHAIYVI
Nucleotide
Download Length: 531 bp
>NTDB_id=1098115 ACM2KS_RS14245 WP_060558092.1 3051305..3051835(+) (ssb) [Proteus mirabilis strain SH-8]
ATGGCAAGTAAAGGCGTGAATAAATGTATTCTCATTGGTCACCTAGGGCAGGATCCAGAAATCCGCTATATGCCATCAGG
TGGCGCAGTCGCTAATCTCACACTAGCCACATCGGAATCGTGGCGTGATAAACAAACCGGTGAGATGAAAGAAAAAACCG
AGTGGCATCGAGTATGCATCTTCGGAAAATTAGCGGAAATTGCAGGTGAATATCTGAGAAAAGGAAGTCAGGTATATATC
GAGGGTTCTCTTCAAACTCGTAAATGGCAAGACCAAAGCGGACAAGACCGATACACAACGGAAGTGGTAGTTAATATCGG
CGGTACGATGCAGATGTTAGGCGGTAATCAGGCAGGAAGCCAGAAACCTCAGCAGAATCAAGGATGGGGTCAACCGCAAG
CACCGAAAGCACCGCAACAACAACCTAAACAACAAACACCACAAAGTGAACCTCCGATGGATTTCGATGACGACATCCCC
TTCGCTCCTATCGGACTCCCCTACCCACGCCACGCTATTTATGTGATTTAA
ATGGCAAGTAAAGGCGTGAATAAATGTATTCTCATTGGTCACCTAGGGCAGGATCCAGAAATCCGCTATATGCCATCAGG
TGGCGCAGTCGCTAATCTCACACTAGCCACATCGGAATCGTGGCGTGATAAACAAACCGGTGAGATGAAAGAAAAAACCG
AGTGGCATCGAGTATGCATCTTCGGAAAATTAGCGGAAATTGCAGGTGAATATCTGAGAAAAGGAAGTCAGGTATATATC
GAGGGTTCTCTTCAAACTCGTAAATGGCAAGACCAAAGCGGACAAGACCGATACACAACGGAAGTGGTAGTTAATATCGG
CGGTACGATGCAGATGTTAGGCGGTAATCAGGCAGGAAGCCAGAAACCTCAGCAGAATCAAGGATGGGGTCAACCGCAAG
CACCGAAAGCACCGCAACAACAACCTAAACAACAAACACCACAAAGTGAACCTCCGATGGATTTCGATGACGACATCCCC
TTCGCTCCTATCGGACTCCCCTACCCACGCCACGCTATTTATGTGATTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Vibrio cholerae strain A1552 |
70.787 |
100 |
0.716 |
| ssb | Glaesserella parasuis strain SC1401 |
52.198 |
100 |
0.54 |
| ssb | Neisseria gonorrhoeae MS11 |
44.886 |
100 |
0.449 |
| ssb | Neisseria meningitidis MC58 |
44.886 |
100 |
0.449 |