Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   ACMXKM_RS05240 Genome accession   NZ_CP180475
Coordinates   1114527..1114991 (-) Length   154 a.a.
NCBI ID   WP_415759795.1    Uniprot ID   -
Organism   Pasteurella multocida strain 200011     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1108410..1154421 1114527..1114991 within 0


Gene organization within MGE regions


Location: 1108410..1154421
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACMXKM_RS05180 - 1108410..1109399 (+) 990 WP_075266281.1 tyrosine-type recombinase/integrase -
  ACMXKM_RS05185 - 1109396..1109677 (-) 282 WP_071523558.1 hypothetical protein -
  ACMXKM_RS05190 - 1109752..1110237 (-) 486 WP_415759790.1 pyruvate kinase -
  ACMXKM_RS05195 - 1110323..1110622 (-) 300 WP_016533427.1 hypothetical protein -
  ACMXKM_RS05200 - 1110632..1111165 (-) 534 WP_415759953.1 DUF551 domain-containing protein -
  ACMXKM_RS05205 - 1111177..1111611 (-) 435 WP_415759955.1 DUF551 domain-containing protein -
  ACMXKM_RS05210 - 1111614..1112096 (-) 483 WP_415760006.1 class I SAM-dependent methyltransferase -
  ACMXKM_RS05215 - 1112130..1112420 (-) 291 WP_016569997.1 hypothetical protein -
  ACMXKM_RS05220 - 1112417..1113016 (-) 600 WP_016569996.1 hypothetical protein -
  ACMXKM_RS05225 - 1113069..1113857 (-) 789 WP_014391448.1 DUF2303 family protein -
  ACMXKM_RS05230 - 1113929..1114282 (-) 354 WP_016570064.1 hypothetical protein -
  ACMXKM_RS05235 - 1114325..1114516 (-) 192 WP_319028966.1 hypothetical protein -
  ACMXKM_RS05240 ssb 1114527..1114991 (-) 465 WP_415759795.1 single-stranded DNA-binding protein Machinery gene
  ACMXKM_RS05245 - 1114991..1115650 (-) 660 WP_409138899.1 translocation protein TolB precursor -
  ACMXKM_RS05250 - 1115637..1116590 (-) 954 WP_014391451.1 recombinase RecT -
  ACMXKM_RS05255 - 1116592..1116879 (-) 288 WP_064964850.1 hypothetical protein -
  ACMXKM_RS05260 - 1116892..1117128 (-) 237 WP_415759798.1 hypothetical protein -
  ACMXKM_RS05265 - 1117100..1117399 (-) 300 WP_014391453.1 hypothetical protein -
  ACMXKM_RS05270 - 1117466..1117777 (+) 312 WP_014390710.1 hypothetical protein -
  ACMXKM_RS05275 - 1117839..1118792 (-) 954 WP_415760008.1 KilA-N domain-containing protein -
  ACMXKM_RS05280 - 1118817..1119143 (-) 327 Protein_1034 Bro-N domain-containing protein -
  ACMXKM_RS05285 - 1119360..1119623 (-) 264 WP_071522857.1 hypothetical protein -
  ACMXKM_RS05290 - 1119848..1120078 (-) 231 WP_016533507.1 hypothetical protein -
  ACMXKM_RS05295 - 1120718..1121098 (-) 381 WP_415759958.1 hypothetical protein -
  ACMXKM_RS05300 - 1121103..1121555 (-) 453 WP_195187226.1 helix-turn-helix domain-containing protein -
  ACMXKM_RS05305 - 1121558..1121863 (-) 306 WP_195187227.1 type II toxin-antitoxin system HigB family toxin -
  ACMXKM_RS05310 - 1121952..1122641 (-) 690 WP_064775603.1 XRE family transcriptional regulator -
  ACMXKM_RS05315 - 1122769..1122978 (+) 210 WP_005720263.1 helix-turn-helix transcriptional regulator -
  ACMXKM_RS05320 - 1122999..1123274 (+) 276 WP_005756640.1 hypothetical protein -
  ACMXKM_RS05325 - 1123332..1124033 (+) 702 WP_064775604.1 phage antirepressor KilAC domain-containing protein -
  ACMXKM_RS05330 - 1124030..1124383 (+) 354 WP_014390722.1 HNH endonuclease -
  ACMXKM_RS05335 - 1124385..1125287 (+) 903 WP_016533442.1 hypothetical protein -
  ACMXKM_RS05340 - 1125287..1125976 (+) 690 WP_016533441.1 replication protein P -
  ACMXKM_RS05345 - 1125980..1126516 (+) 537 WP_014391470.1 phage N-6-adenine-methyltransferase -
  ACMXKM_RS05350 - 1126506..1126964 (+) 459 WP_016569985.1 recombination protein NinB -
  ACMXKM_RS05355 - 1127038..1127250 (+) 213 WP_016533468.1 hypothetical protein -
  ACMXKM_RS05360 - 1127338..1127940 (+) 603 WP_415759810.1 recombination protein NinG -
  ACMXKM_RS05365 - 1127942..1128403 (+) 462 WP_241952116.1 antiterminator Q family protein -
  ACMXKM_RS05375 - 1128729..1129094 (+) 366 WP_415759812.1 phage holin, lambda family -
  ACMXKM_RS05380 - 1129066..1129650 (+) 585 WP_238300475.1 glycoside hydrolase family 19 protein -
  ACMXKM_RS05385 - 1129653..1129976 (+) 324 WP_238300473.1 DUF2570 family protein -
  ACMXKM_RS05390 - 1130188..1130556 (-) 369 WP_014391478.1 helix-turn-helix domain-containing protein -
  ACMXKM_RS05395 - 1130593..1130853 (-) 261 WP_005720780.1 type II toxin-antitoxin system RelE family toxin -
  ACMXKM_RS05400 - 1131144..1131620 (+) 477 WP_075269225.1 DUF1441 family protein -
  ACMXKM_RS05405 - 1131623..1133731 (+) 2109 WP_238300231.1 phage terminase large subunit family protein -
  ACMXKM_RS05410 - 1133728..1133949 (+) 222 WP_014391481.1 hypothetical protein -
  ACMXKM_RS05415 - 1133946..1135484 (+) 1539 WP_238300232.1 phage portal protein -
  ACMXKM_RS05420 - 1135420..1137438 (+) 2019 WP_238300233.1 ClpP-like prohead protease/major capsid protein fusion protein -
  ACMXKM_RS05425 - 1137511..1137837 (+) 327 WP_415759963.1 DUF2190 family protein -
  ACMXKM_RS05430 - 1137830..1138123 (+) 294 WP_005719722.1 hypothetical protein -
  ACMXKM_RS05435 - 1138123..1138674 (+) 552 WP_223131947.1 phage tail protein -
  ACMXKM_RS05440 gpU 1138671..1139078 (+) 408 WP_223131948.1 phage minor tail U family protein -
  ACMXKM_RS05445 - 1139075..1139581 (+) 507 WP_415759966.1 phage tail tube protein -
  ACMXKM_RS05450 - 1139587..1139976 (+) 390 WP_016533230.1 phage minor tail protein G -
  ACMXKM_RS05455 - 1139997..1140299 (+) 303 WP_225529681.1 phage tail assembly protein T -
  ACMXKM_RS05460 - 1140286..1142439 (+) 2154 WP_075269215.1 phage tail length tape measure family protein -
  ACMXKM_RS05465 - 1142436..1142786 (+) 351 WP_005719622.1 phage tail protein -
  ACMXKM_RS05470 - 1142874..1143587 (+) 714 WP_319047058.1 phage minor tail protein L -
  ACMXKM_RS05475 - 1143592..1144335 (+) 744 WP_016569980.1 C40 family peptidase -
  ACMXKM_RS05480 - 1144278..1144898 (+) 621 WP_014667799.1 tail assembly protein -
  ACMXKM_RS05485 - 1144902..1150796 (+) 5895 WP_415759970.1 phage tail protein -
  ACMXKM_RS05490 - 1150844..1151167 (+) 324 WP_139616918.1 hypothetical protein -
  ACMXKM_RS05495 - 1151593..1152429 (+) 837 WP_014390712.1 KilA-N domain-containing protein -
  ACMXKM_RS05500 - 1152732..1153418 (+) 687 WP_250021904.1 KilA-N domain-containing protein -
  ACMXKM_RS05505 folE 1153765..1154421 (+) 657 WP_005726594.1 GTP cyclohydrolase I FolE -

Sequence


Protein


Download         Length: 154 a.a.        Molecular weight: 17175.98 Da        Isoelectric Point: 6.9823

>NTDB_id=1095934 ACMXKM_RS05240 WP_415759795.1 1114527..1114991(-) (ssb) [Pasteurella multocida strain 200011]
MAGVNKAIIVGNLGNDPEIRTMPNGDPVAKISVATSESWIDKNTGERKTQTEWHSIVFYRRQAEICGQYLKKGSKVYVEG
RLRTRKWQDQNGQDRYTTEIQGDVLQMLDSRQDSQAQANAQANAQAPQNNAYANAKAGKPVQQADSFEDDSIPF

Nucleotide


Download         Length: 465 bp        

>NTDB_id=1095934 ACMXKM_RS05240 WP_415759795.1 1114527..1114991(-) (ssb) [Pasteurella multocida strain 200011]
ATGGCTGGAGTCAATAAAGCAATTATCGTGGGGAATTTGGGAAACGATCCTGAAATCCGCACAATGCCAAATGGCGACCC
TGTTGCAAAAATCAGCGTCGCAACCAGTGAAAGCTGGATCGACAAAAATACTGGCGAACGAAAAACACAAACTGAATGGC
ATTCTATCGTGTTCTATCGTCGCCAAGCAGAAATTTGCGGTCAGTATCTCAAAAAAGGATCGAAAGTGTATGTGGAAGGG
CGTTTAAGAACTCGTAAATGGCAAGACCAAAACGGGCAAGATCGCTACACCACTGAAATCCAAGGCGACGTATTGCAGAT
GTTAGATAGTCGCCAAGATTCACAAGCACAAGCTAACGCACAAGCTAACGCACAAGCACCGCAAAACAACGCTTATGCGA
ATGCGAAAGCTGGAAAGCCAGTGCAACAGGCTGATAGTTTTGAAGATGATAGCATACCTTTTTAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Glaesserella parasuis strain SC1401

61.878

100

0.727

  ssb Vibrio cholerae strain A1552

47.701

100

0.539

  ssb Neisseria meningitidis MC58

42.197

100

0.474

  ssb Neisseria gonorrhoeae MS11

42.197

100

0.474


Multiple sequence alignment