Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   ACL6EO_RS12160 Genome accession   NZ_CP178718
Coordinates   2511404..2511718 (-) Length   104 a.a.
NCBI ID   WP_017418140.1    Uniprot ID   A0AAP3YC32
Organism   Bacillus velezensis strain SY1154     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2506404..2516718
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACL6EO_RS12115 (ACL6EO_12115) sinI 2507085..2507258 (+) 174 WP_014418369.1 anti-repressor SinI Regulator
  ACL6EO_RS12120 (ACL6EO_12120) sinR 2507292..2507627 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  ACL6EO_RS12125 (ACL6EO_12125) tasA 2507675..2508460 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  ACL6EO_RS12130 (ACL6EO_12130) sipW 2508525..2509109 (-) 585 WP_012117977.1 signal peptidase I SipW -
  ACL6EO_RS12135 (ACL6EO_12135) tapA 2509081..2509752 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  ACL6EO_RS12140 (ACL6EO_12140) - 2510011..2510340 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  ACL6EO_RS12145 (ACL6EO_12145) - 2510381..2510560 (-) 180 WP_003153093.1 YqzE family protein -
  ACL6EO_RS12150 (ACL6EO_12150) comGG 2510617..2510994 (-) 378 WP_276350926.1 competence type IV pilus minor pilin ComGG Machinery gene
  ACL6EO_RS12155 (ACL6EO_12155) comGF 2510995..2511390 (-) 396 WP_025649850.1 competence type IV pilus minor pilin ComGF -
  ACL6EO_RS12160 (ACL6EO_12160) comGE 2511404..2511718 (-) 315 WP_017418140.1 competence type IV pilus minor pilin ComGE Machinery gene
  ACL6EO_RS12165 (ACL6EO_12165) comGD 2511702..2512139 (-) 438 WP_095061019.1 competence type IV pilus minor pilin ComGD Machinery gene
  ACL6EO_RS12170 (ACL6EO_12170) comGC 2512129..2512437 (-) 309 WP_014418376.1 competence type IV pilus major pilin ComGC Machinery gene
  ACL6EO_RS12175 (ACL6EO_12175) comGB 2512442..2513479 (-) 1038 WP_053284924.1 competence type IV pilus assembly protein ComGB Machinery gene
  ACL6EO_RS12180 (ACL6EO_12180) comGA 2513466..2514536 (-) 1071 WP_413383808.1 competence type IV pilus ATPase ComGA Machinery gene
  ACL6EO_RS12185 (ACL6EO_12185) - 2514729..2515679 (-) 951 WP_014418379.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 104 a.a.        Molecular weight: 11785.77 Da        Isoelectric Point: 5.8181

>NTDB_id=1090929 ACL6EO_RS12160 WP_017418140.1 2511404..2511718(-) (comGE) [Bacillus velezensis strain SY1154]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTGMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADPGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=1090929 ACL6EO_RS12160 WP_017418140.1 2511404..2511718(-) (comGE) [Bacillus velezensis strain SY1154]
ATGCTAAACGGAAATAAGGGGTTCTCTACTATTGAAACGCTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGCTGACAGATGGCCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCCCGGCGAAAAAGAAATGTGCCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481

Multiple sequence alignment