Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   ACL6EO_RS12115 Genome accession   NZ_CP178718
Coordinates   2507085..2507258 (+) Length   57 a.a.
NCBI ID   WP_014418369.1    Uniprot ID   I2C7P2
Organism   Bacillus velezensis strain SY1154     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2502085..2512258
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACL6EO_RS12100 (ACL6EO_12100) gcvT 2502898..2503998 (-) 1101 WP_061890721.1 glycine cleavage system aminomethyltransferase GcvT -
  ACL6EO_RS12105 (ACL6EO_12105) - 2504422..2506092 (+) 1671 WP_021494309.1 DEAD/DEAH box helicase -
  ACL6EO_RS12110 (ACL6EO_12110) - 2506114..2506908 (+) 795 WP_014418368.1 YqhG family protein -
  ACL6EO_RS12115 (ACL6EO_12115) sinI 2507085..2507258 (+) 174 WP_014418369.1 anti-repressor SinI Regulator
  ACL6EO_RS12120 (ACL6EO_12120) sinR 2507292..2507627 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  ACL6EO_RS12125 (ACL6EO_12125) tasA 2507675..2508460 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  ACL6EO_RS12130 (ACL6EO_12130) sipW 2508525..2509109 (-) 585 WP_012117977.1 signal peptidase I SipW -
  ACL6EO_RS12135 (ACL6EO_12135) tapA 2509081..2509752 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  ACL6EO_RS12140 (ACL6EO_12140) - 2510011..2510340 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  ACL6EO_RS12145 (ACL6EO_12145) - 2510381..2510560 (-) 180 WP_003153093.1 YqzE family protein -
  ACL6EO_RS12150 (ACL6EO_12150) comGG 2510617..2510994 (-) 378 WP_276350926.1 competence type IV pilus minor pilin ComGG Machinery gene
  ACL6EO_RS12155 (ACL6EO_12155) comGF 2510995..2511390 (-) 396 WP_025649850.1 competence type IV pilus minor pilin ComGF -
  ACL6EO_RS12160 (ACL6EO_12160) comGE 2511404..2511718 (-) 315 WP_017418140.1 competence type IV pilus minor pilin ComGE Machinery gene
  ACL6EO_RS12165 (ACL6EO_12165) comGD 2511702..2512139 (-) 438 WP_095061019.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6642.60 Da        Isoelectric Point: 9.8168

>NTDB_id=1090926 ACL6EO_RS12115 WP_014418369.1 2507085..2507258(+) (sinI) [Bacillus velezensis strain SY1154]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=1090926 ACL6EO_RS12115 WP_014418369.1 2507085..2507258(+) (sinI) [Bacillus velezensis strain SY1154]
ATGAAAAATGCAAAAACAGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-37)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB I2C7P2

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719


Multiple sequence alignment