Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | ACL6EO_RS12115 | Genome accession | NZ_CP178718 |
| Coordinates | 2507085..2507258 (+) | Length | 57 a.a. |
| NCBI ID | WP_014418369.1 | Uniprot ID | I2C7P2 |
| Organism | Bacillus velezensis strain SY1154 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2502085..2512258
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACL6EO_RS12100 (ACL6EO_12100) | gcvT | 2502898..2503998 (-) | 1101 | WP_061890721.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| ACL6EO_RS12105 (ACL6EO_12105) | - | 2504422..2506092 (+) | 1671 | WP_021494309.1 | DEAD/DEAH box helicase | - |
| ACL6EO_RS12110 (ACL6EO_12110) | - | 2506114..2506908 (+) | 795 | WP_014418368.1 | YqhG family protein | - |
| ACL6EO_RS12115 (ACL6EO_12115) | sinI | 2507085..2507258 (+) | 174 | WP_014418369.1 | anti-repressor SinI | Regulator |
| ACL6EO_RS12120 (ACL6EO_12120) | sinR | 2507292..2507627 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| ACL6EO_RS12125 (ACL6EO_12125) | tasA | 2507675..2508460 (-) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| ACL6EO_RS12130 (ACL6EO_12130) | sipW | 2508525..2509109 (-) | 585 | WP_012117977.1 | signal peptidase I SipW | - |
| ACL6EO_RS12135 (ACL6EO_12135) | tapA | 2509081..2509752 (-) | 672 | WP_014418371.1 | amyloid fiber anchoring/assembly protein TapA | - |
| ACL6EO_RS12140 (ACL6EO_12140) | - | 2510011..2510340 (+) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| ACL6EO_RS12145 (ACL6EO_12145) | - | 2510381..2510560 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| ACL6EO_RS12150 (ACL6EO_12150) | comGG | 2510617..2510994 (-) | 378 | WP_276350926.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| ACL6EO_RS12155 (ACL6EO_12155) | comGF | 2510995..2511390 (-) | 396 | WP_025649850.1 | competence type IV pilus minor pilin ComGF | - |
| ACL6EO_RS12160 (ACL6EO_12160) | comGE | 2511404..2511718 (-) | 315 | WP_017418140.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| ACL6EO_RS12165 (ACL6EO_12165) | comGD | 2511702..2512139 (-) | 438 | WP_095061019.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6642.60 Da Isoelectric Point: 9.8168
>NTDB_id=1090926 ACL6EO_RS12115 WP_014418369.1 2507085..2507258(+) (sinI) [Bacillus velezensis strain SY1154]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=1090926 ACL6EO_RS12115 WP_014418369.1 2507085..2507258(+) (sinI) [Bacillus velezensis strain SY1154]
ATGAAAAATGCAAAAACAGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAACAGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
71.93 |
100 |
0.719 |