Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   ACL6EQ_RS11840 Genome accession   NZ_CP178716
Coordinates   2306251..2306634 (-) Length   127 a.a.
NCBI ID   WP_185183735.1    Uniprot ID   -
Organism   Bacillus subtilis strain SY1483     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2301251..2311634
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACL6EQ_RS11800 (ACL6EQ_11800) sinI 2302184..2302357 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  ACL6EQ_RS11805 (ACL6EQ_11805) sinR 2302391..2302726 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  ACL6EQ_RS11810 (ACL6EQ_11810) tasA 2302819..2303604 (-) 786 WP_326382994.1 biofilm matrix protein TasA -
  ACL6EQ_RS11815 (ACL6EQ_11815) sipW 2303668..2304240 (-) 573 WP_003246088.1 signal peptidase I SipW -
  ACL6EQ_RS11820 (ACL6EQ_11820) tapA 2304224..2304985 (-) 762 WP_024573387.1 amyloid fiber anchoring/assembly protein TapA -
  ACL6EQ_RS11825 (ACL6EQ_11825) yqzG 2305258..2305584 (+) 327 WP_413358461.1 YqzG/YhdC family protein -
  ACL6EQ_RS11830 (ACL6EQ_11830) spoIITA 2305626..2305805 (-) 180 WP_003230176.1 YqzE family protein -
  ACL6EQ_RS11835 (ACL6EQ_11835) comGG 2305876..2306250 (-) 375 WP_144500712.1 ComG operon protein ComGG Machinery gene
  ACL6EQ_RS11840 (ACL6EQ_11840) comGF 2306251..2306634 (-) 384 WP_185183735.1 ComG operon protein ComGF Machinery gene
  ACL6EQ_RS11845 (ACL6EQ_11845) comGE 2306660..2307007 (-) 348 WP_185183734.1 ComG operon protein 5 Machinery gene
  ACL6EQ_RS11850 (ACL6EQ_11850) comGD 2306991..2307422 (-) 432 WP_024573390.1 comG operon protein ComGD Machinery gene
  ACL6EQ_RS11855 (ACL6EQ_11855) comGC 2307412..2307708 (-) 297 WP_185183733.1 comG operon protein ComGC Machinery gene
  ACL6EQ_RS11860 (ACL6EQ_11860) comGB 2307722..2308759 (-) 1038 WP_185183732.1 comG operon protein ComGB Machinery gene
  ACL6EQ_RS11865 (ACL6EQ_11865) comGA 2308746..2309816 (-) 1071 WP_085186492.1 competence protein ComGA Machinery gene
  ACL6EQ_RS11870 (ACL6EQ_11870) - 2310078..2310227 (-) 150 WP_250622588.1 hypothetical protein -
  ACL6EQ_RS11875 (ACL6EQ_11875) corA 2310229..2311182 (-) 954 WP_032677123.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14375.44 Da        Isoelectric Point: 5.5348

>NTDB_id=1090771 ACL6EQ_RS11840 WP_185183735.1 2306251..2306634(-) (comGF) [Bacillus subtilis strain SY1483]
MLISGSLAAIFHLFLSRQQEYDGFTQQEWMISVEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFEIYHSMIRKRVDG
KGHVPILDHITAMKADFENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=1090771 ACL6EQ_RS11840 WP_185183735.1 2306251..2306634(-) (comGF) [Bacillus subtilis strain SY1483]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAATATGACGGTTTCACACAGCA
AGAATGGATGATTTCGGTAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGGCAGGACATCCGTTTCGAAATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATTTTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

96.063

100

0.961


Multiple sequence alignment