Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   ACL6EQ_RS11800 Genome accession   NZ_CP178716
Coordinates   2302184..2302357 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain SY1483     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2297184..2307357
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACL6EQ_RS11785 (ACL6EQ_11785) gcvT 2297983..2299071 (-) 1089 WP_413358456.1 glycine cleavage system aminomethyltransferase GcvT -
  ACL6EQ_RS11790 (ACL6EQ_11790) hepAA 2299513..2301186 (+) 1674 WP_004398544.1 DEAD/DEAH box helicase -
  ACL6EQ_RS11795 (ACL6EQ_11795) yqhG 2301207..2302001 (+) 795 WP_003230200.1 YqhG family protein -
  ACL6EQ_RS11800 (ACL6EQ_11800) sinI 2302184..2302357 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  ACL6EQ_RS11805 (ACL6EQ_11805) sinR 2302391..2302726 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  ACL6EQ_RS11810 (ACL6EQ_11810) tasA 2302819..2303604 (-) 786 WP_326382994.1 biofilm matrix protein TasA -
  ACL6EQ_RS11815 (ACL6EQ_11815) sipW 2303668..2304240 (-) 573 WP_003246088.1 signal peptidase I SipW -
  ACL6EQ_RS11820 (ACL6EQ_11820) tapA 2304224..2304985 (-) 762 WP_024573387.1 amyloid fiber anchoring/assembly protein TapA -
  ACL6EQ_RS11825 (ACL6EQ_11825) yqzG 2305258..2305584 (+) 327 WP_413358461.1 YqzG/YhdC family protein -
  ACL6EQ_RS11830 (ACL6EQ_11830) spoIITA 2305626..2305805 (-) 180 WP_003230176.1 YqzE family protein -
  ACL6EQ_RS11835 (ACL6EQ_11835) comGG 2305876..2306250 (-) 375 WP_144500712.1 ComG operon protein ComGG Machinery gene
  ACL6EQ_RS11840 (ACL6EQ_11840) comGF 2306251..2306634 (-) 384 WP_185183735.1 ComG operon protein ComGF Machinery gene
  ACL6EQ_RS11845 (ACL6EQ_11845) comGE 2306660..2307007 (-) 348 WP_185183734.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=1090768 ACL6EQ_RS11800 WP_003230187.1 2302184..2302357(+) (sinI) [Bacillus subtilis strain SY1483]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=1090768 ACL6EQ_RS11800 WP_003230187.1 2302184..2302357(+) (sinI) [Bacillus subtilis strain SY1483]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment