Detailed information NTG1090482

Bioinformatically predicted

Overview

• Name: comGD
• Type: Machinery gene
• Locus tag: ACKUFW_RS11820
• Genome accession: NZ_CP178610
• Coordinates: 2445144..2445581 (-)
• Length: 145 a.a.
• NCBI ID: WP_025852922.1
• Uniprot ID: -
• Organism: Bacillus velezensis strain GUMHT p116
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2440144..2450581

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
ACKUFW_RS11770 (ACKUFW_11770)	sinI	2440529..2440702 (+)	174	WP_003153105.1	anti-repressor SinI	Regulator
ACKUFW_RS11775 (ACKUFW_11775)	sinR	2440736..2441071 (+)	336	WP_003153104.1	transcriptional regulator SinR	Regulator
ACKUFW_RS11780 (ACKUFW_11780)	tasA	2441119..2441904 (-)	786	WP_007408329.1	biofilm matrix protein TasA	-
ACKUFW_RS11785 (ACKUFW_11785)	sipW	2441968..2442552 (-)	585	WP_060562614.1	signal peptidase I SipW	-
ACKUFW_RS11790 (ACKUFW_11790)	tapA	2442524..2443195 (-)	672	WP_202735627.1	amyloid fiber anchoring/assembly protein TapA	-
ACKUFW_RS11795 (ACKUFW_11795)	-	2443454..2443783 (+)	330	WP_071391612.1	DUF3889 domain-containing protein	-
ACKUFW_RS11800 (ACKUFW_11800)	-	2443823..2444002 (-)	180	WP_003153093.1	YqzE family protein	-
ACKUFW_RS11805 (ACKUFW_11805)	comGG	2444059..2444436 (-)	378	WP_071391611.1	competence type IV pilus minor pilin ComGG	Machinery gene
ACKUFW_RS11810 (ACKUFW_11810)	comGF	2444437..2444832 (-)	396	WP_046559876.1	competence type IV pilus minor pilin ComGF	-
ACKUFW_RS11815 (ACKUFW_11815)	comGE	2444846..2445160 (-)	315	WP_015388003.1	competence type IV pilus minor pilin ComGE	Machinery gene
ACKUFW_RS11820 (ACKUFW_11820)	comGD	2445144..2445581 (-)	438	WP_025852922.1	competence type IV pilus minor pilin ComGD	Machinery gene
ACKUFW_RS11825 (ACKUFW_11825)	comGC	2445571..2445879 (-)	309	WP_003153087.1	competence type IV pilus major pilin ComGC	Machinery gene
ACKUFW_RS11830 (ACKUFW_11830)	comGB	2445884..2446921 (-)	1038	WP_063174751.1	competence type IV pilus assembly protein ComGB	Machinery gene
ACKUFW_RS11835 (ACKUFW_11835)	comGA	2446908..2447978 (-)	1071	WP_070082113.1	competence type IV pilus ATPase ComGA	Machinery gene
ACKUFW_RS11840 (ACKUFW_11840)	-	2448169..2449119 (-)	951	WP_071391609.1	magnesium transporter CorA family protein	-
ACKUFW_RS11845 (ACKUFW_11845)	-	2449265..2450566 (+)	1302	WP_070082114.1	hemolysin family protein	-

Sequence

Protein

• Length: 145 a.a.
• Molecular weight: 16268.78 Da
• Isoelectric Point: 10.1850

>NTDB_id=1090482 ACKUFW_RS11820 WP_025852922.1 2445144..2445581(-) (comGD) [Bacillus velezensis strain GUMHT p116]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPVCTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSAGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide

• Length: 438 bp

>NTDB_id=1090482 ACKUFW_RS11820 WP_025852922.1 2445144..2445581(-) (comGD) [Bacillus velezensis strain GUMHT p116]
TTGAACAATAACAGGCGGACAGAAAACGGGTTTACCCTTCTTGAAAGCCTGATTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGTCTGCACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTTCAAAAAGATA
TTCAGCTTGCGCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAGCCGGAAGGATTGTCGAGCGTTCTTTTGATTCGCTTCACATTACACTTGTAACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATTCAATTGAAGAGCGCCGGGTTCACCTATGAGATCACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (5-31)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGD	Bacillus subtilis subsp. subtilis str. 168	54.795	100	0.552