Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   ACKUFW_RS11815 Genome accession   NZ_CP178610
Coordinates   2444846..2445160 (-) Length   104 a.a.
NCBI ID   WP_015388003.1    Uniprot ID   -
Organism   Bacillus velezensis strain GUMHT p116     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2439846..2450160
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACKUFW_RS11770 (ACKUFW_11770) sinI 2440529..2440702 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  ACKUFW_RS11775 (ACKUFW_11775) sinR 2440736..2441071 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  ACKUFW_RS11780 (ACKUFW_11780) tasA 2441119..2441904 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  ACKUFW_RS11785 (ACKUFW_11785) sipW 2441968..2442552 (-) 585 WP_060562614.1 signal peptidase I SipW -
  ACKUFW_RS11790 (ACKUFW_11790) tapA 2442524..2443195 (-) 672 WP_202735627.1 amyloid fiber anchoring/assembly protein TapA -
  ACKUFW_RS11795 (ACKUFW_11795) - 2443454..2443783 (+) 330 WP_071391612.1 DUF3889 domain-containing protein -
  ACKUFW_RS11800 (ACKUFW_11800) - 2443823..2444002 (-) 180 WP_003153093.1 YqzE family protein -
  ACKUFW_RS11805 (ACKUFW_11805) comGG 2444059..2444436 (-) 378 WP_071391611.1 competence type IV pilus minor pilin ComGG Machinery gene
  ACKUFW_RS11810 (ACKUFW_11810) comGF 2444437..2444832 (-) 396 WP_046559876.1 competence type IV pilus minor pilin ComGF -
  ACKUFW_RS11815 (ACKUFW_11815) comGE 2444846..2445160 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  ACKUFW_RS11820 (ACKUFW_11820) comGD 2445144..2445581 (-) 438 WP_025852922.1 competence type IV pilus minor pilin ComGD Machinery gene
  ACKUFW_RS11825 (ACKUFW_11825) comGC 2445571..2445879 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  ACKUFW_RS11830 (ACKUFW_11830) comGB 2445884..2446921 (-) 1038 WP_063174751.1 competence type IV pilus assembly protein ComGB Machinery gene
  ACKUFW_RS11835 (ACKUFW_11835) comGA 2446908..2447978 (-) 1071 WP_070082113.1 competence type IV pilus ATPase ComGA Machinery gene
  ACKUFW_RS11840 (ACKUFW_11840) - 2448169..2449119 (-) 951 WP_071391609.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 104 a.a.        Molecular weight: 11844.85 Da        Isoelectric Point: 6.9470

>NTDB_id=1090481 ACKUFW_RS11815 WP_015388003.1 2444846..2445160(-) (comGE) [Bacillus velezensis strain GUMHT p116]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTGMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=1090481 ACKUFW_RS11815 WP_015388003.1 2444846..2445160(-) (comGE) [Bacillus velezensis strain GUMHT p116]
ATGCTAAACGGAAATAAGGGGTTCTCTACTATTGAAACACTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGCTGACAGATGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCGCGGCGAAAAAGAAATGTGTCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481

Multiple sequence alignment