Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | ACKUFW_RS11770 | Genome accession | NZ_CP178610 |
| Coordinates | 2440529..2440702 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain GUMHT p116 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2435529..2445702
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACKUFW_RS11755 (ACKUFW_11755) | gcvT | 2436346..2437446 (-) | 1101 | WP_071391617.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| ACKUFW_RS11760 (ACKUFW_11760) | - | 2437870..2439540 (+) | 1671 | WP_046559872.1 | DEAD/DEAH box helicase | - |
| ACKUFW_RS11765 (ACKUFW_11765) | - | 2439558..2440352 (+) | 795 | WP_071391615.1 | YqhG family protein | - |
| ACKUFW_RS11770 (ACKUFW_11770) | sinI | 2440529..2440702 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| ACKUFW_RS11775 (ACKUFW_11775) | sinR | 2440736..2441071 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| ACKUFW_RS11780 (ACKUFW_11780) | tasA | 2441119..2441904 (-) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| ACKUFW_RS11785 (ACKUFW_11785) | sipW | 2441968..2442552 (-) | 585 | WP_060562614.1 | signal peptidase I SipW | - |
| ACKUFW_RS11790 (ACKUFW_11790) | tapA | 2442524..2443195 (-) | 672 | WP_202735627.1 | amyloid fiber anchoring/assembly protein TapA | - |
| ACKUFW_RS11795 (ACKUFW_11795) | - | 2443454..2443783 (+) | 330 | WP_071391612.1 | DUF3889 domain-containing protein | - |
| ACKUFW_RS11800 (ACKUFW_11800) | - | 2443823..2444002 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| ACKUFW_RS11805 (ACKUFW_11805) | comGG | 2444059..2444436 (-) | 378 | WP_071391611.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| ACKUFW_RS11810 (ACKUFW_11810) | comGF | 2444437..2444832 (-) | 396 | WP_046559876.1 | competence type IV pilus minor pilin ComGF | - |
| ACKUFW_RS11815 (ACKUFW_11815) | comGE | 2444846..2445160 (-) | 315 | WP_015388003.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| ACKUFW_RS11820 (ACKUFW_11820) | comGD | 2445144..2445581 (-) | 438 | WP_025852922.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=1090478 ACKUFW_RS11770 WP_003153105.1 2440529..2440702(+) (sinI) [Bacillus velezensis strain GUMHT p116]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=1090478 ACKUFW_RS11770 WP_003153105.1 2440529..2440702(+) (sinI) [Bacillus velezensis strain GUMHT p116]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |