Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   ACKUFW_RS11770 Genome accession   NZ_CP178610
Coordinates   2440529..2440702 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain GUMHT p116     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2435529..2445702
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACKUFW_RS11755 (ACKUFW_11755) gcvT 2436346..2437446 (-) 1101 WP_071391617.1 glycine cleavage system aminomethyltransferase GcvT -
  ACKUFW_RS11760 (ACKUFW_11760) - 2437870..2439540 (+) 1671 WP_046559872.1 DEAD/DEAH box helicase -
  ACKUFW_RS11765 (ACKUFW_11765) - 2439558..2440352 (+) 795 WP_071391615.1 YqhG family protein -
  ACKUFW_RS11770 (ACKUFW_11770) sinI 2440529..2440702 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  ACKUFW_RS11775 (ACKUFW_11775) sinR 2440736..2441071 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  ACKUFW_RS11780 (ACKUFW_11780) tasA 2441119..2441904 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  ACKUFW_RS11785 (ACKUFW_11785) sipW 2441968..2442552 (-) 585 WP_060562614.1 signal peptidase I SipW -
  ACKUFW_RS11790 (ACKUFW_11790) tapA 2442524..2443195 (-) 672 WP_202735627.1 amyloid fiber anchoring/assembly protein TapA -
  ACKUFW_RS11795 (ACKUFW_11795) - 2443454..2443783 (+) 330 WP_071391612.1 DUF3889 domain-containing protein -
  ACKUFW_RS11800 (ACKUFW_11800) - 2443823..2444002 (-) 180 WP_003153093.1 YqzE family protein -
  ACKUFW_RS11805 (ACKUFW_11805) comGG 2444059..2444436 (-) 378 WP_071391611.1 competence type IV pilus minor pilin ComGG Machinery gene
  ACKUFW_RS11810 (ACKUFW_11810) comGF 2444437..2444832 (-) 396 WP_046559876.1 competence type IV pilus minor pilin ComGF -
  ACKUFW_RS11815 (ACKUFW_11815) comGE 2444846..2445160 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  ACKUFW_RS11820 (ACKUFW_11820) comGD 2445144..2445581 (-) 438 WP_025852922.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=1090478 ACKUFW_RS11770 WP_003153105.1 2440529..2440702(+) (sinI) [Bacillus velezensis strain GUMHT p116]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=1090478 ACKUFW_RS11770 WP_003153105.1 2440529..2440702(+) (sinI) [Bacillus velezensis strain GUMHT p116]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-37)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702


Multiple sequence alignment