Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   ABFT42_RS12415 Genome accession   NZ_CP178596
Coordinates   2392713..2393087 (-) Length   124 a.a.
NCBI ID   WP_339177153.1    Uniprot ID   -
Organism   Bacillus mojavensis strain C3     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2387713..2398087
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ABFT42_RS12375 (ABFT42_12375) - 2388048..2388842 (+) 795 WP_168748226.1 YqhG family protein -
  ABFT42_RS12380 (ABFT42_12380) sinI 2389022..2389195 (+) 174 WP_339190978.1 anti-repressor SinI Regulator
  ABFT42_RS12385 (ABFT42_12385) sinR 2389229..2389564 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  ABFT42_RS12390 (ABFT42_12390) tasA 2389652..2390437 (-) 786 WP_010334917.1 biofilm matrix protein TasA -
  ABFT42_RS12395 (ABFT42_12395) sipW 2390502..2391086 (-) 585 WP_339190980.1 signal peptidase I SipW -
  ABFT42_RS12400 (ABFT42_12400) tapA 2391058..2391819 (-) 762 WP_413286393.1 amyloid fiber anchoring/assembly protein TapA -
  ABFT42_RS12405 (ABFT42_12405) - 2392096..2392419 (+) 324 WP_168748230.1 YqzG/YhdC family protein -
  ABFT42_RS12410 (ABFT42_12410) - 2392462..2392641 (-) 180 WP_003236949.1 YqzE family protein -
  ABFT42_RS12415 (ABFT42_12415) comGG 2392713..2393087 (-) 375 WP_339177153.1 competence type IV pilus minor pilin ComGG Machinery gene
  ABFT42_RS12420 (ABFT42_12420) comGF 2393088..2393495 (-) 408 WP_413286394.1 competence type IV pilus minor pilin ComGF Machinery gene
  ABFT42_RS12425 (ABFT42_12425) comGE 2393497..2393844 (-) 348 WP_268451134.1 competence type IV pilus minor pilin ComGE Machinery gene
  ABFT42_RS12430 (ABFT42_12430) comGD 2393828..2394259 (-) 432 WP_010334924.1 competence type IV pilus minor pilin ComGD Machinery gene
  ABFT42_RS12435 (ABFT42_12435) comGC 2394249..2394545 (-) 297 WP_010334925.1 competence type IV pilus major pilin ComGC Machinery gene
  ABFT42_RS12440 (ABFT42_12440) comGB 2394559..2395596 (-) 1038 WP_413286395.1 competence type IV pilus assembly protein ComGB Machinery gene
  ABFT42_RS12445 (ABFT42_12445) comGA 2395583..2396653 (-) 1071 WP_168748237.1 competence protein ComGA Machinery gene
  ABFT42_RS12450 (ABFT42_12450) - 2397006..2397176 (-) 171 WP_339177165.1 hypothetical protein -

Sequence


Protein


Download         Length: 124 a.a.        Molecular weight: 14267.30 Da        Isoelectric Point: 7.4185

>NTDB_id=1090316 ABFT42_RS12415 WP_339177153.1 2392713..2393087(-) (comGG) [Bacillus mojavensis strain C3]
MHCSKGFIYPAVLFTFALVLLVVNFTASQFVSRHMFEKETKEYYTGENLLQNGALLSIRHILEHRQGQKGSQQLPYGQVS
YDIHETTIKEQQEITLKAITESGTEKSAKLLFDQNQKKLLSWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=1090316 ABFT42_RS12415 WP_339177153.1 2392713..2393087(-) (comGG) [Bacillus mojavensis strain C3]
ATGCACTGCTCAAAAGGTTTTATCTATCCAGCCGTTCTTTTTACATTTGCCCTTGTGCTGCTGGTTGTGAATTTCACCGC
CTCTCAATTTGTTTCCCGCCATATGTTTGAGAAGGAAACAAAAGAGTATTATACAGGAGAAAATCTGCTGCAAAATGGTG
CGCTTCTATCCATCAGGCATATTCTTGAGCACAGACAAGGCCAAAAGGGTTCACAGCAGCTTCCATATGGACAGGTTTCT
TATGACATTCACGAAACAACCATAAAAGAACAGCAAGAAATCACCCTCAAAGCCATCACAGAGTCGGGAACAGAAAAAAG
CGCCAAGCTGCTGTTCGATCAAAATCAGAAAAAACTGCTGAGCTGGACAGAATAA

Domains


Predicted by InterproScan.

(31-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

68.548

100

0.685


Multiple sequence alignment