Detailed information
Overview
| Name | comW | Type | Regulator |
| Locus tag | ACAM21_RS00110 | Genome accession | NZ_AP031395 |
| Coordinates | 21282..21518 (+) | Length | 78 a.a. |
| NCBI ID | WP_000939545.1 | Uniprot ID | - |
| Organism | Streptococcus pneumoniae strain 16P29 | ||
| Function | stabilization and activation of ComX (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 12174..91063 | 21282..21518 | within | 0 |
| IS/Tn | 20765..20965 | 21282..21518 | flank | 317 |
Gene organization within MGE regions
Location: 12174..91063
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACAM21_RS00065 (SPNE16P29_00130) | ftsH | 12174..14132 (+) | 1959 | WP_000744557.1 | ATP-dependent zinc metalloprotease FtsH | - |
| ACAM21_RS00070 (SPNE16P29_00140) | comX/comX2 | 14254..14733 (+) | 480 | WP_000588897.1 | sigma-70 family RNA polymerase sigma factor | Regulator |
| ACAM21_RS00105 | - | 20235..21016 (-) | 782 | Protein_14 | transposase | - |
| ACAM21_RS00110 (SPNE16P29_00160) | comW | 21282..21518 (+) | 237 | WP_000939545.1 | sigma(X)-activator ComW | Regulator |
| ACAM21_RS00115 (SPNE16P29_00170) | - | 21749..23035 (+) | 1287 | WP_000205044.1 | adenylosuccinate synthase | - |
| ACAM21_RS00120 (SPNE16P29_00180) | - | 23299..24447 (-) | 1149 | WP_000876727.1 | site-specific integrase | - |
| ACAM21_RS00125 (SPNE16P29_00190) | - | 24618..25418 (-) | 801 | WP_000539947.1 | HIRAN domain-containing protein | - |
| ACAM21_RS00130 (SPNE16P29_00200) | - | 25545..26300 (-) | 756 | WP_000069476.1 | XRE family transcriptional regulator | - |
| ACAM21_RS00135 (SPNE16P29_00210) | - | 26474..26680 (+) | 207 | WP_001171134.1 | helix-turn-helix transcriptional regulator | - |
| ACAM21_RS00140 (SPNE16P29_00240) | - | 26988..27665 (-) | 678 | WP_000289447.1 | DUF4145 domain-containing protein | - |
| ACAM21_RS00145 (SPNE16P29_00250) | - | 27720..28433 (+) | 714 | WP_001002349.1 | ORF6C domain-containing protein | - |
| ACAM21_RS00150 (SPNE16P29_00260) | - | 28446..28703 (+) | 258 | WP_000370959.1 | hypothetical protein | - |
| ACAM21_RS00155 (SPNE16P29_00270) | - | 28789..29109 (+) | 321 | WP_000462823.1 | hypothetical protein | - |
| ACAM21_RS00160 (SPNE16P29_00280) | - | 29125..29421 (+) | 297 | WP_050241622.1 | hypothetical protein | - |
| ACAM21_RS00165 (SPNE16P29_00290) | - | 29412..30284 (+) | 873 | WP_050241623.1 | phage replisome organizer N-terminal domain-containing protein | - |
| ACAM21_RS00170 (SPNE16P29_00300) | - | 30357..30524 (+) | 168 | WP_000233203.1 | hypothetical protein | - |
| ACAM21_RS00175 (SPNE16P29_00310) | - | 30511..30720 (+) | 210 | WP_050241624.1 | hypothetical protein | - |
| ACAM21_RS00180 (SPNE16P29_00320) | - | 30695..31009 (+) | 315 | WP_050241625.1 | hypothetical protein | - |
| ACAM21_RS00185 (SPNE16P29_00330) | - | 31011..31211 (+) | 201 | WP_050241626.1 | hypothetical protein | - |
| ACAM21_RS00190 (SPNE16P29_00340) | - | 31202..31540 (+) | 339 | WP_050241627.1 | helix-turn-helix domain-containing protein | - |
| ACAM21_RS00195 (SPNE16P29_00350) | - | 31537..32001 (+) | 465 | WP_050244776.1 | hypothetical protein | - |
| ACAM21_RS00200 (SPNE16P29_00360) | - | 32110..32652 (+) | 543 | WP_001028147.1 | site-specific integrase | - |
| ACAM21_RS00205 (SPNE16P29_00380) | - | 33193..33399 (+) | 207 | WP_223842409.1 | HNH endonuclease | - |
| ACAM21_RS00210 (SPNE16P29_00390) | - | 33536..34021 (+) | 486 | WP_000601030.1 | hypothetical protein | - |
| ACAM21_RS00215 (SPNE16P29_00400) | - | 34014..35726 (+) | 1713 | WP_000230006.1 | terminase TerL endonuclease subunit | - |
| ACAM21_RS00220 (SPNE16P29_00410) | - | 35735..36877 (+) | 1143 | WP_001812652.1 | phage portal protein | - |
| ACAM21_RS00225 (SPNE16P29_00420) | - | 36924..37466 (+) | 543 | WP_000413203.1 | HK97 family phage prohead protease | - |
| ACAM21_RS00230 (SPNE16P29_00430) | - | 37481..38734 (+) | 1254 | WP_000855224.1 | phage major capsid protein | - |
| ACAM21_RS00235 (SPNE16P29_00440) | - | 38760..39095 (+) | 336 | WP_000154006.1 | hypothetical protein | - |
| ACAM21_RS00240 (SPNE16P29_00450) | - | 39092..39397 (+) | 306 | WP_000842790.1 | head-tail adaptor protein | - |
| ACAM21_RS00245 (SPNE16P29_00460) | - | 39397..39744 (+) | 348 | WP_001074487.1 | hypothetical protein | - |
| ACAM21_RS00250 (SPNE16P29_00470) | - | 39731..40075 (+) | 345 | WP_000534621.1 | hypothetical protein | - |
| ACAM21_RS00255 (SPNE16P29_00480) | - | 40089..40757 (+) | 669 | WP_000221469.1 | hypothetical protein | - |
| ACAM21_RS00260 (SPNE16P29_00490) | - | 40759..41235 (+) | 477 | WP_000591561.1 | hypothetical protein | - |
| ACAM21_RS00265 (SPNE16P29_00500) | - | 41422..44160 (+) | 2739 | WP_050241635.1 | phage tail tape measure protein | - |
| ACAM21_RS00270 (SPNE16P29_00510) | - | 44157..44879 (+) | 723 | WP_000161559.1 | phage tail protein | - |
| ACAM21_RS00275 (SPNE16P29_00520) | - | 44880..53006 (+) | 8127 | WP_317638279.1 | phage tail spike protein | - |
| ACAM21_RS00280 | - | 53003..53120 (+) | 118 | Protein_49 | dihydrodipicolinate reductase | - |
| ACAM21_RS00285 (SPNE16P29_00530) | - | 53101..53304 (+) | 204 | WP_001091118.1 | hypothetical protein | - |
| ACAM21_RS00290 (SPNE16P29_00540) | - | 53307..53657 (+) | 351 | WP_050218371.1 | hypothetical protein | - |
| ACAM21_RS00295 (SPNE16P29_00550) | - | 53667..54083 (+) | 417 | WP_050211460.1 | phage holin family protein | - |
| ACAM21_RS00300 (SPNE16P29_00560) | - | 54087..54419 (+) | 333 | WP_001186242.1 | phage holin | - |
| ACAM21_RS00305 (SPNE16P29_00570) | lytA | 54423..55379 (+) | 957 | WP_050218372.1 | N-acetylmuramoyl-L-alanine amidase LytA | - |
| ACAM21_RS00310 (SPNE16P29_00580) | - | 55599..55778 (-) | 180 | WP_001209433.1 | hypothetical protein | - |
| ACAM21_RS00315 (SPNE16P29_00590) | - | 55920..56069 (-) | 150 | WP_001030863.1 | hypothetical protein | - |
| ACAM21_RS00320 (SPNE16P29_00600) | tadA | 56350..56817 (+) | 468 | WP_000291870.1 | tRNA adenosine(34) deaminase TadA | - |
| ACAM21_RS00330 (SPNE16P29_00610) | - | 57003..57446 (+) | 444 | WP_000701992.1 | dUTP diphosphatase | - |
| ACAM21_RS00335 (SPNE16P29_00620) | - | 57448..57963 (+) | 516 | WP_001842035.1 | histidine phosphatase family protein | - |
| ACAM21_RS00340 (SPNE16P29_00630) | radA | 57977..59338 (+) | 1362 | WP_074017595.1 | DNA repair protein RadA | Machinery gene |
| ACAM21_RS00345 (SPNE16P29_00640) | - | 59411..59908 (+) | 498 | WP_001809263.1 | carbonic anhydrase | - |
| ACAM21_RS00350 (SPNE16P29_00660) | - | 59933..60747 (+) | 815 | Protein_62 | PrsW family intramembrane metalloprotease | - |
| ACAM21_RS00355 (SPNE16P29_00670) | - | 60892..61860 (+) | 969 | WP_000010163.1 | ribose-phosphate diphosphokinase | - |
| ACAM21_RS00360 | - | 61994..62275 (-) | 282 | Protein_64 | ISL3 family transposase | - |
| ACAM21_RS00365 | - | 62402..63309 (-) | 908 | Protein_65 | Rpn family recombination-promoting nuclease/putative transposase | - |
| ACAM21_RS00370 (SPNE16P29_00710) | polA | 63560..66193 (+) | 2634 | WP_369608077.1 | DNA polymerase I | - |
| ACAM21_RS00375 (SPNE16P29_00720) | - | 66278..66715 (+) | 438 | WP_000076479.1 | CoA-binding protein | - |
| ACAM21_RS00380 | - | 66756..66914 (+) | 159 | WP_050096739.1 | hypothetical protein | - |
| ACAM21_RS00385 (SPNE16P29_00730) | - | 66943..67953 (-) | 1011 | WP_000009158.1 | YeiH family protein | - |
| ACAM21_RS00390 (SPNE16P29_00750) | - | 68102..69271 (+) | 1170 | WP_000366342.1 | pyridoxal phosphate-dependent aminotransferase | - |
| ACAM21_RS00395 (SPNE16P29_00760) | recO | 69268..70038 (+) | 771 | WP_000616164.1 | DNA repair protein RecO | - |
| ACAM21_RS00400 (SPNE16P29_00770) | plsX | 70035..71027 (+) | 993 | WP_000717458.1 | phosphate acyltransferase PlsX | - |
| ACAM21_RS00405 (SPNE16P29_00780) | - | 71033..71266 (+) | 234 | WP_000136447.1 | acyl carrier protein | - |
| ACAM21_RS00410 (SPNE16P29_00790) | - | 71312..71602 (+) | 291 | Protein_74 | IS5/IS1182 family transposase | - |
| ACAM21_RS00415 (SPNE16P29_00800) | blpU | 71805..72035 (+) | 231 | WP_001093075.1 | bacteriocin-like peptide BlpU | - |
| ACAM21_RS00420 | - | 72038..72163 (+) | 126 | WP_000346297.1 | PncF family bacteriocin immunity protein | - |
| ACAM21_RS00425 | - | 72574..72768 (+) | 195 | WP_000756776.1 | hypothetical protein | - |
| ACAM21_RS00430 (SPNE16P29_00810) | - | 72789..73682 (+) | 894 | WP_000343888.1 | XRE family transcriptional regulator | - |
| ACAM21_RS00435 (SPNE16P29_00820) | - | 74225..74521 (+) | 297 | WP_000837726.1 | uberolysin/carnocyclin family circular bacteriocin | - |
| ACAM21_RS00440 | - | 74528..75664 (+) | 1137 | WP_000698828.1 | hypothetical protein | - |
| ACAM21_RS00445 (SPNE16P29_00830) | - | 75661..76143 (+) | 483 | WP_001232094.1 | stage II sporulation protein M | - |
| ACAM21_RS00450 (SPNE16P29_00840) | - | 76140..76736 (+) | 597 | WP_000687787.1 | ATP-binding cassette domain-containing protein | - |
| ACAM21_RS00455 (SPNE16P29_00850) | - | 76717..77208 (+) | 492 | WP_000671990.1 | hypothetical protein | - |
| ACAM21_RS00460 (SPNE16P29_00860) | comA | 77588..79741 (+) | 2154 | WP_000668293.1 | peptide cleavage/export ABC transporter ComA | Regulator |
| ACAM21_RS00465 (SPNE16P29_00870) | comB | 79754..81103 (+) | 1350 | WP_219599548.1 | competence pheromone export protein ComB | Regulator |
| ACAM21_RS00470 (SPNE16P29_00880) | purC | 81273..81980 (+) | 708 | WP_219599549.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
| ACAM21_RS00475 (SPNE16P29_00890) | - | 82037..85762 (+) | 3726 | WP_000361203.1 | phosphoribosylformylglycinamidine synthase | - |
| ACAM21_RS00480 (SPNE16P29_00900) | purF | 85855..87297 (+) | 1443 | WP_219599550.1 | amidophosphoribosyltransferase | - |
| ACAM21_RS00485 (SPNE16P29_00910) | purM | 87334..88356 (+) | 1023 | WP_000182575.1 | phosphoribosylformylglycinamidine cyclo-ligase | - |
| ACAM21_RS00490 (SPNE16P29_00920) | purN | 88353..88898 (+) | 546 | WP_000717506.1 | phosphoribosylglycinamide formyltransferase | - |
| ACAM21_RS00495 (SPNE16P29_00930) | - | 88982..89491 (+) | 510 | WP_000894018.1 | VanZ family protein | - |
| ACAM21_RS00500 (SPNE16P29_00940) | purH | 89516..91063 (+) | 1548 | WP_219599551.1 | bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase | - |
Sequence
Protein
Download Length: 78 a.a. Molecular weight: 9658.13 Da Isoelectric Point: 6.7051
>NTDB_id=109018 ACAM21_RS00110 WP_000939545.1 21282..21518(+) (comW) [Streptococcus pneumoniae strain 16P29]
MLQKIYEQMANFYDSIEEEYGPTFGDNFDWEHVHFKFLIYYLVRYGIGCRKDFIVYHYRVAYRLYLEKLVMNRGFISC
MLQKIYEQMANFYDSIEEEYGPTFGDNFDWEHVHFKFLIYYLVRYGIGCRKDFIVYHYRVAYRLYLEKLVMNRGFISC
Nucleotide
Download Length: 237 bp
>NTDB_id=109018 ACAM21_RS00110 WP_000939545.1 21282..21518(+) (comW) [Streptococcus pneumoniae strain 16P29]
ATGTTACAAAAAATTTATGAGCAGATGGCTAATTTCTATGATAGTATTGAAGAAGAGTATGGTCCTACATTTGGTGATAA
TTTTGACTGGGAACATGTTCATTTTAAATTTTTAATTTATTATTTAGTAAGATATGGCATTGGTTGTCGTAAGGATTTTA
TTGTTTACCATTATCGTGTTGCTTATCGTTTGTATCTTGAAAAATTGGTAATGAATCGGGGTTTTATTTCTTGTTGA
ATGTTACAAAAAATTTATGAGCAGATGGCTAATTTCTATGATAGTATTGAAGAAGAGTATGGTCCTACATTTGGTGATAA
TTTTGACTGGGAACATGTTCATTTTAAATTTTTAATTTATTATTTAGTAAGATATGGCATTGGTTGTCGTAAGGATTTTA
TTGTTTACCATTATCGTGTTGCTTATCGTTTGTATCTTGAAAAATTGGTAATGAATCGGGGTTTTATTTCTTGTTGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comW | Streptococcus pneumoniae Rx1 |
100 |
100 |
1 |
| comW | Streptococcus pneumoniae D39 |
100 |
100 |
1 |
| comW | Streptococcus pneumoniae R6 |
100 |
100 |
1 |
| comW | Streptococcus pneumoniae TIGR4 |
100 |
100 |
1 |
| comW | Streptococcus mitis SK321 |
75.641 |
100 |
0.756 |
| comW | Streptococcus mitis NCTC 12261 |
75.325 |
98.718 |
0.744 |