Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   ACE2AB_RS14965 Genome accession   NZ_CP178406
Coordinates   3140481..3140834 (-) Length   117 a.a.
NCBI ID   WP_004738307.1    Uniprot ID   -
Organism   Acinetobacter baumannii strain L4773hy     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 3139008..3176929 3140481..3140834 within 0


Gene organization within MGE regions


Location: 3139008..3176929
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACE2AB_RS14955 (ACE2AB_14955) - 3139008..3140168 (-) 1161 WP_004738311.1 tyrosine-type recombinase/integrase -
  ACE2AB_RS14960 (ACE2AB_14960) - 3140257..3140460 (-) 204 WP_004738309.1 hypothetical protein -
  ACE2AB_RS14965 (ACE2AB_14965) ssb 3140481..3140834 (-) 354 WP_004738307.1 single-stranded DNA-binding protein Machinery gene
  ACE2AB_RS14970 (ACE2AB_14970) - 3140822..3141139 (-) 318 WP_004738305.1 hypothetical protein -
  ACE2AB_RS14975 (ACE2AB_14975) - 3141132..3141485 (-) 354 WP_004738303.1 hypothetical protein -
  ACE2AB_RS14980 (ACE2AB_14980) - 3141489..3142007 (-) 519 WP_004738302.1 hypothetical protein -
  ACE2AB_RS14985 (ACE2AB_14985) - 3142075..3142677 (-) 603 WP_004738299.1 hypothetical protein -
  ACE2AB_RS14990 (ACE2AB_14990) - 3142694..3145420 (-) 2727 WP_004738296.1 toprim domain-containing protein -
  ACE2AB_RS14995 (ACE2AB_14995) - 3145430..3145600 (-) 171 WP_004738295.1 hypothetical protein -
  ACE2AB_RS15000 (ACE2AB_15000) - 3145615..3145854 (-) 240 WP_004738293.1 hypothetical protein -
  ACE2AB_RS15005 (ACE2AB_15005) - 3145857..3146057 (-) 201 WP_004738291.1 hypothetical protein -
  ACE2AB_RS15010 (ACE2AB_15010) - 3146141..3146491 (+) 351 WP_004738288.1 hypothetical protein -
  ACE2AB_RS15015 (ACE2AB_15015) - 3146488..3147066 (-) 579 WP_004738286.1 hypothetical protein -
  ACE2AB_RS15020 (ACE2AB_15020) - 3147063..3147386 (-) 324 WP_004738284.1 hypothetical protein -
  ACE2AB_RS15025 (ACE2AB_15025) - 3147802..3148809 (+) 1008 WP_004738282.1 WYL domain-containing protein -
  ACE2AB_RS15030 (ACE2AB_15030) - 3148841..3149650 (+) 810 WP_004738281.1 trypsin-like peptidase domain-containing protein -
  ACE2AB_RS15035 (ACE2AB_15035) - 3149983..3151215 (-) 1233 WP_004738280.1 acyltransferase family protein -
  ACE2AB_RS15040 (ACE2AB_15040) - 3151369..3151722 (-) 354 WP_004738279.1 hypothetical protein -
  ACE2AB_RS15045 (ACE2AB_15045) - 3151727..3152122 (-) 396 WP_004738278.1 hypothetical protein -
  ACE2AB_RS15050 (ACE2AB_15050) - 3152122..3152409 (-) 288 WP_004738277.1 ogr/Delta-like zinc finger family protein -
  ACE2AB_RS15055 (ACE2AB_15055) - 3152528..3152719 (+) 192 WP_079270046.1 Com family DNA-binding transcriptional regulator -
  ACE2AB_RS15060 (ACE2AB_15060) - 3152688..3153479 (+) 792 WP_004738276.1 DNA adenine methylase -
  ACE2AB_RS15065 (ACE2AB_15065) - 3153476..3154693 (-) 1218 WP_004738275.1 contractile injection system protein, VgrG/Pvc8 family -
  ACE2AB_RS15070 (ACE2AB_15070) - 3154697..3155116 (-) 420 WP_004738274.1 phage tail protein -
  ACE2AB_RS15075 (ACE2AB_15075) - 3155131..3158760 (-) 3630 WP_004738273.1 hypothetical protein -
  ACE2AB_RS15080 (ACE2AB_15080) - 3158757..3158825 (-) 69 WP_238826551.1 GpE family phage tail protein -
  ACE2AB_RS15085 (ACE2AB_15085) - 3158885..3159265 (-) 381 WP_196085662.1 phage tail assembly protein -
  ACE2AB_RS15090 (ACE2AB_15090) - 3159327..3159842 (-) 516 WP_196085661.1 phage major tail tube protein -
  ACE2AB_RS15095 (ACE2AB_15095) - 3159854..3161023 (-) 1170 WP_004738266.1 phage tail sheath protein -
  ACE2AB_RS15100 (ACE2AB_15100) - 3161132..3161629 (-) 498 WP_196085660.1 hypothetical protein -
  ACE2AB_RS15105 (ACE2AB_15105) - 3161631..3164630 (-) 3000 WP_218264719.1 phage tail protein -
  ACE2AB_RS15110 (ACE2AB_15110) - 3164631..3165167 (-) 537 WP_005112001.1 phage tail protein I -
  ACE2AB_RS15115 (ACE2AB_15115) - 3165167..3166060 (-) 894 WP_254231394.1 baseplate J/gp47 family protein -
  ACE2AB_RS15120 (ACE2AB_15120) - 3166081..3166437 (-) 357 WP_196085348.1 GPW/gp25 family protein -
  ACE2AB_RS15125 (ACE2AB_15125) - 3166434..3166988 (-) 555 WP_196085347.1 phage baseplate assembly protein V -
  ACE2AB_RS15130 (ACE2AB_15130) - 3167049..3167510 (-) 462 WP_032058820.1 phage virion morphogenesis protein -
  ACE2AB_RS15135 (ACE2AB_15135) - 3167514..3168044 (-) 531 WP_005112011.1 phage tail protein -
  ACE2AB_RS15140 (ACE2AB_15140) - 3168041..3168871 (-) 831 WP_156190991.1 N-acetylmuramidase domain-containing protein -
  ACE2AB_RS15145 (ACE2AB_15145) - 3168868..3169125 (-) 258 WP_004738245.1 phage holin family protein -
  ACE2AB_RS15150 (ACE2AB_15150) - 3169122..3169481 (-) 360 WP_004703727.1 putative holin -
  ACE2AB_RS15155 (ACE2AB_15155) - 3169484..3169693 (-) 210 WP_004703729.1 tail protein X -
  ACE2AB_RS15160 (ACE2AB_15160) - 3169690..3170139 (-) 450 WP_196085346.1 head completion/stabilization protein -
  ACE2AB_RS15165 (ACE2AB_15165) gpM 3170240..3171004 (-) 765 WP_196085345.1 phage terminase small subunit -
  ACE2AB_RS15170 (ACE2AB_15170) - 3171011..3172021 (-) 1011 WP_001247975.1 phage major capsid protein, P2 family -
  ACE2AB_RS15175 (ACE2AB_15175) - 3172057..3172917 (-) 861 WP_196085344.1 GPO family capsid scaffolding protein -
  ACE2AB_RS15180 (ACE2AB_15180) - 3173096..3174874 (+) 1779 WP_196085343.1 terminase large subunit domain-containing protein -
  ACE2AB_RS15185 (ACE2AB_15185) - 3174871..3175917 (+) 1047 WP_254231395.1 phage portal protein -
  ACE2AB_RS15190 (ACE2AB_15190) - 3175928..3176143 (+) 216 WP_227552920.1 hypothetical protein -
  ACE2AB_RS15195 (ACE2AB_15195) - 3176251..3176430 (+) 180 WP_000009390.1 type II toxin-antitoxin system HicA family toxin -
  ACE2AB_RS15200 (ACE2AB_15200) - 3176516..3176929 (+) 414 WP_032058837.1 antitoxin -

Sequence


Protein


Download         Length: 117 a.a.        Molecular weight: 13204.83 Da        Isoelectric Point: 9.8037

>NTDB_id=1089519 ACE2AB_RS14965 WP_004738307.1 3140481..3140834(-) (ssb) [Acinetobacter baumannii strain L4773hy]
MRGINKVILVGSLGANPITKHYPNGNTYVQFSIATSEKYQDKNTGEWIENTEWHRIIAYGRLGEVATQILKKGSKVYVEG
SLRTRQVTDQRGQQGYITEVRANTFQSLDSLPQANPY

Nucleotide


Download         Length: 354 bp        

>NTDB_id=1089519 ACE2AB_RS14965 WP_004738307.1 3140481..3140834(-) (ssb) [Acinetobacter baumannii strain L4773hy]
ATGCGCGGGATAAATAAAGTCATTCTTGTGGGAAGTTTAGGTGCAAATCCAATAACCAAACATTACCCGAACGGTAATAC
TTACGTTCAGTTTTCGATTGCTACTTCAGAAAAGTATCAAGATAAAAACACAGGTGAATGGATTGAGAATACGGAATGGC
ATCGAATTATTGCATACGGTCGATTAGGTGAGGTTGCCACTCAAATCTTAAAAAAAGGTTCAAAAGTTTATGTAGAGGGT
TCTTTACGAACAAGACAAGTTACCGACCAAAGAGGTCAGCAAGGTTATATAACCGAAGTAAGGGCAAACACCTTTCAGTC
TTTAGATAGCCTTCCGCAAGCAAACCCTTATTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Glaesserella parasuis strain SC1401

54.545

94.017

0.513

  ssb Vibrio cholerae strain A1552

54.545

84.615

0.462

  ssb Neisseria gonorrhoeae MS11

42.857

89.744

0.385

  ssb Neisseria meningitidis MC58

42.857

89.744

0.385


Multiple sequence alignment