Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   ACK3B6_RS12640 Genome accession   NZ_CP176792
Coordinates   2502439..2502813 (-) Length   124 a.a.
NCBI ID   WP_101864528.1    Uniprot ID   -
Organism   Bacillus halotolerans strain BCP32     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2497439..2507813
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACK3B6_RS12600 (ACK3B6_12600) - 2497771..2498565 (+) 795 WP_105955581.1 YqhG family protein -
  ACK3B6_RS12605 (ACK3B6_12605) sinI 2498749..2498922 (+) 174 WP_024122036.1 anti-repressor SinI Regulator
  ACK3B6_RS12610 (ACK3B6_12610) sinR 2498956..2499291 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  ACK3B6_RS12615 (ACK3B6_12615) tasA 2499378..2500163 (-) 786 WP_105955580.1 biofilm matrix protein TasA -
  ACK3B6_RS12620 (ACK3B6_12620) sipW 2500228..2500812 (-) 585 WP_105955579.1 signal peptidase I SipW -
  ACK3B6_RS12625 (ACK3B6_12625) tapA 2500784..2501545 (-) 762 WP_105955621.1 amyloid fiber anchoring/assembly protein TapA -
  ACK3B6_RS12630 (ACK3B6_12630) - 2501822..2502145 (+) 324 WP_024122040.1 YqzG/YhdC family protein -
  ACK3B6_RS12635 (ACK3B6_12635) - 2502188..2502367 (-) 180 WP_003236949.1 YqzE family protein -
  ACK3B6_RS12640 (ACK3B6_12640) comGG 2502439..2502813 (-) 375 WP_101864528.1 competence type IV pilus minor pilin ComGG Machinery gene
  ACK3B6_RS12645 (ACK3B6_12645) comGF 2502814..2503197 (-) 384 WP_181185692.1 competence type IV pilus minor pilin ComGF Machinery gene
  ACK3B6_RS12650 (ACK3B6_12650) comGE 2503223..2503570 (-) 348 WP_105955577.1 competence type IV pilus minor pilin ComGE Machinery gene
  ACK3B6_RS12655 (ACK3B6_12655) comGD 2503554..2503985 (-) 432 WP_105955576.1 competence type IV pilus minor pilin ComGD Machinery gene
  ACK3B6_RS12660 (ACK3B6_12660) comGC 2503975..2504271 (-) 297 WP_010334925.1 competence type IV pilus major pilin ComGC Machinery gene
  ACK3B6_RS12665 (ACK3B6_12665) comGB 2504285..2505322 (-) 1038 WP_202853060.1 competence type IV pilus assembly protein ComGB Machinery gene
  ACK3B6_RS12670 (ACK3B6_12670) comGA 2505309..2506379 (-) 1071 WP_095713275.1 competence protein ComGA Machinery gene
  ACK3B6_RS12675 (ACK3B6_12675) - 2506702..2507112 (-) 411 WP_105955574.1 CBS domain-containing protein -

Sequence

Protein


Download         Length: 124 a.a.        Molecular weight: 14484.62 Da        Isoelectric Point: 9.5334

>NTDB_id=1083002 ACK3B6_RS12640 WP_101864528.1 2502439..2502813(-) (comGG) [Bacillus halotolerans strain BCP32]
MYYSKGFIYPAVLFTFALVMLIVNFTAPQFVSRHMFEKETKEYYTGENLLQNGALLSIRHILEHRPGRKGSQQFQYGHVS
YDIRKTTIKEQQEITLKAITESGTEKSAQLLFDQNQKKLLSWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=1083002 ACK3B6_RS12640 WP_101864528.1 2502439..2502813(-) (comGG) [Bacillus halotolerans strain BCP32]
ATGTACTACTCAAAAGGGTTTATCTATCCGGCTGTTCTTTTTACATTTGCCCTTGTGATGCTGATTGTGAATTTCACCGC
CCCTCAATTTGTTTCACGCCATATGTTTGAGAAGGAAACAAAAGAGTATTACACAGGAGAAAATCTGCTGCAAAATGGCG
CGCTTCTATCCATCAGGCATATACTTGAGCACAGACCAGGCCGAAAGGGTTCACAGCAGTTTCAATATGGACATGTTTCT
TATGACATTCGCAAAACAACCATAAAAGAACAGCAAGAAATCACCCTTAAAGCCATCACAGAGTCGGGAACAGAAAAAAG
CGCTCAGCTGCTGTTCGATCAAAATCAGAAAAAACTGCTGAGCTGGACAGAATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(31-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

69.355

100

0.694

Multiple sequence alignment