Detailed information NTG1080683

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: ACKW6F_RS11620
• Genome accession: NZ_CP176527
• Coordinates: 2300067..2300360 (-)
• Length: 97 a.a.
• NCBI ID: WP_024422977.1
• Uniprot ID: A0A0M2EIN6
• Organism: Bacillus safensis strain D-62
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2295067..2305360

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
ACKW6F_RS11570 (ACKW6F_11570)	sinR	2295234..2295569 (+)	336	WP_024422969.1	transcriptional regulator SinR	Regulator
ACKW6F_RS11575 (ACKW6F_11575)	tasA	2295637..2296437 (-)	801	WP_024422970.1	biofilm matrix protein TasA	-
ACKW6F_RS11580 (ACKW6F_11580)	sipW	2296492..2297064 (-)	573	WP_024422971.1	signal peptidase I SipW	-
ACKW6F_RS11585 (ACKW6F_11585)	tapA	2297117..2297644 (-)	528	WP_024422972.1	amyloid fiber anchoring/assembly protein TapA	-
ACKW6F_RS11590 (ACKW6F_11590)	-	2297944..2298222 (+)	279	WP_171464609.1	DUF3889 domain-containing protein	-
ACKW6F_RS11595 (ACKW6F_11595)	-	2298257..2298451 (-)	195	WP_149126478.1	YqzE family protein	-
ACKW6F_RS11600 (ACKW6F_11600)	-	2298511..2298894 (-)	384	WP_073206276.1	competence type IV pilus minor pilin ComGG	-
ACKW6F_RS11605 (ACKW6F_11605)	comGF	2298891..2299418 (-)	528	WP_335343444.1	competence type IV pilus minor pilin ComGF	-
ACKW6F_RS11610 (ACKW6F_11610)	comGE	2299330..2299644 (-)	315	WP_149126477.1	competence type IV pilus minor pilin ComGE	-
ACKW6F_RS11615 (ACKW6F_11615)	comGD	2299628..2300074 (-)	447	WP_149126476.1	competence type IV pilus minor pilin ComGD	-
ACKW6F_RS11620 (ACKW6F_11620)	comGC	2300067..2300360 (-)	294	WP_024422977.1	competence type IV pilus major pilin ComGC	Machinery gene
ACKW6F_RS11625 (ACKW6F_11625)	comGB	2300377..2301417 (-)	1041	WP_103131948.1	competence type IV pilus assembly protein ComGB	-
ACKW6F_RS11630 (ACKW6F_11630)	comGA	2301398..2302468 (-)	1071	WP_025092972.1	competence type IV pilus ATPase ComGA	Machinery gene
ACKW6F_RS11635 (ACKW6F_11635)	-	2302649..2303524 (-)	876	WP_024422979.1	STAS domain-containing protein	-
ACKW6F_RS11645 (ACKW6F_11645)	-	2303748..2304128 (-)	381	WP_007501232.1	Spx/MgsR family RNA polymerase-binding regulatory protein	-
ACKW6F_RS11650 (ACKW6F_11650)	-	2304342..2304584 (+)	243	WP_003217440.1	DUF2626 domain-containing protein	-
ACKW6F_RS11655 (ACKW6F_11655)	-	2304632..2305270 (-)	639	WP_024422981.1	MBL fold metallo-hydrolase	-

Sequence

Protein

• Length: 97 a.a.
• Molecular weight: 10686.62 Da
• Isoelectric Point: 7.3218

>NTDB_id=1080683 ACKW6F_RS11620 WP_024422977.1 2300067..2300360(-) (comGC) [Bacillus safensis strain D-62]
MNDKGFTLLEMLIVMLVISILLLITIPNITRHHQAIQAKGCEGLKSMVSTQVMAYELEHDGKTPSLAELEKEGYVKKGLT
CPNGKAIVIQNGNVKHE

Nucleotide

• Length: 294 bp

>NTDB_id=1080683 ACKW6F_RS11620 WP_024422977.1 2300067..2300360(-) (comGC) [Bacillus safensis strain D-62]
ATGAATGATAAAGGATTTACCCTGTTAGAAATGTTAATAGTTATGCTCGTAATATCCATTCTTTTACTCATTACCATACC
GAATATCACACGTCATCACCAAGCGATTCAGGCAAAGGGCTGTGAAGGGCTTAAATCAATGGTCAGCACACAAGTGATGG
CATATGAATTGGAGCATGATGGGAAGACGCCATCTTTAGCTGAATTAGAAAAAGAAGGTTATGTCAAAAAGGGGTTAACT
TGTCCTAATGGAAAAGCGATTGTCATTCAAAACGGCAACGTGAAGCATGAATAA

Domains

Predicted by InterProScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (2-25)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Bacillus subtilis subsp. subtilis str. 168	67.01	100	0.67
comGC	Staphylococcus aureus MW2	42.222	92.784	0.392
comGC	Staphylococcus aureus N315	42.222	92.784	0.392