Detailed information NTG1079975

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: ACKWCM_RS11740
• Genome accession: NZ_CP176416
• Coordinates: 2319828..2320121 (-)
• Length: 97 a.a.
• NCBI ID: WP_024422977.1
• Uniprot ID: A0A0M2EIN6
• Organism: Bacillus safensis strain GUCCb3-7
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2314828..2325121

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
ACKWCM_RS11690 (ACKWCM_11690)	sinR	2314989..2315324 (+)	336	WP_024422969.1	transcriptional regulator SinR	Regulator
ACKWCM_RS11695 (ACKWCM_11695)	tasA	2315392..2316192 (-)	801	WP_024422970.1	biofilm matrix protein TasA	-
ACKWCM_RS11700 (ACKWCM_11700)	sipW	2316247..2316819 (-)	573	WP_024422971.1	signal peptidase I SipW	-
ACKWCM_RS11705 (ACKWCM_11705)	tapA	2316872..2317399 (-)	528	WP_098677430.1	amyloid fiber anchoring/assembly protein TapA	-
ACKWCM_RS11710 (ACKWCM_11710)	-	2317699..2317977 (+)	279	WP_171464609.1	DUF3889 domain-containing protein	-
ACKWCM_RS11715 (ACKWCM_11715)	-	2318011..2318205 (-)	195	WP_056767455.1	YqzE family protein	-
ACKWCM_RS11720 (ACKWCM_11720)	-	2318272..2318655 (-)	384	WP_197172668.1	competence type IV pilus minor pilin ComGG	-
ACKWCM_RS11725 (ACKWCM_11725)	comGF	2318652..2319179 (-)	528	WP_311164128.1	competence type IV pilus minor pilin ComGF	-
ACKWCM_RS11730 (ACKWCM_11730)	comGE	2319091..2319405 (-)	315	WP_087978326.1	competence type IV pilus minor pilin ComGE	-
ACKWCM_RS11735 (ACKWCM_11735)	comGD	2319389..2319835 (-)	447	WP_197172667.1	competence type IV pilus minor pilin ComGD	-
ACKWCM_RS11740 (ACKWCM_11740)	comGC	2319828..2320121 (-)	294	WP_024422977.1	competence type IV pilus major pilin ComGC	Machinery gene
ACKWCM_RS11745 (ACKWCM_11745)	comGB	2320138..2321178 (-)	1041	WP_197172666.1	competence type IV pilus assembly protein ComGB	-
ACKWCM_RS11750 (ACKWCM_11750)	comGA	2321159..2322229 (-)	1071	WP_241743547.1	competence type IV pilus ATPase ComGA	Machinery gene
ACKWCM_RS11755 (ACKWCM_11755)	-	2322406..2323281 (-)	876	WP_024422979.1	STAS domain-containing protein	-
ACKWCM_RS11765 (ACKWCM_11765)	-	2323505..2323885 (-)	381	WP_007501232.1	Spx/MgsR family RNA polymerase-binding regulatory protein	-
ACKWCM_RS11770 (ACKWCM_11770)	-	2324098..2324340 (+)	243	WP_003217440.1	DUF2626 domain-containing protein	-
ACKWCM_RS11775 (ACKWCM_11775)	-	2324388..2325026 (-)	639	WP_024422981.1	MBL fold metallo-hydrolase	-

Sequence

Protein

• Length: 97 a.a.
• Molecular weight: 10686.62 Da
• Isoelectric Point: 7.3218

>NTDB_id=1079975 ACKWCM_RS11740 WP_024422977.1 2319828..2320121(-) (comGC) [Bacillus safensis strain GUCCb3-7]
MNDKGFTLLEMLIVMLVISILLLITIPNITRHHQAIQAKGCEGLKSMVSTQVMAYELEHDGKTPSLAELEKEGYVKKGLT
CPNGKAIVIQNGNVKHE

Nucleotide

• Length: 294 bp

>NTDB_id=1079975 ACKWCM_RS11740 WP_024422977.1 2319828..2320121(-) (comGC) [Bacillus safensis strain GUCCb3-7]
ATGAATGATAAAGGATTTACCCTGTTAGAAATGTTAATAGTCATGCTCGTAATATCCATTCTTTTACTCATTACCATACC
GAATATCACACGTCATCACCAAGCGATTCAGGCAAAGGGCTGTGAAGGGCTTAAATCAATGGTCAGCACACAAGTGATGG
CATATGAATTGGAGCATGATGGGAAGACGCCATCTTTAGCTGAATTAGAAAAAGAAGGTTATGTCAAAAAGGGATTAACT
TGTCCTAATGGAAAAGCGATTGTCATTCAAAACGGCAACGTGAAGCATGAATAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (2-25)

3D structure

• AlphaFold DB: A0A0M2EIN6

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Bacillus subtilis subsp. subtilis str. 168	67.01	100	0.67
comGC	Staphylococcus aureus MW2	42.222	92.784	0.392
comGC	Staphylococcus aureus N315	42.222	92.784	0.392