Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   ACKFA7_RS11630 Genome accession   NZ_CP175553
Coordinates   2466175..2466612 (-) Length   145 a.a.
NCBI ID   WP_038459181.1    Uniprot ID   -
Organism   Bacillus amyloliquefaciens strain 4-9-2     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2461175..2471612
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACKFA7_RS11580 (ACKFA7_11580) sinI 2461558..2461731 (+) 174 WP_007612543.1 anti-repressor SinI Regulator
  ACKFA7_RS11585 (ACKFA7_11585) sinR 2461765..2462100 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  ACKFA7_RS11590 (ACKFA7_11590) tasA 2462148..2462933 (-) 786 WP_003153102.1 biofilm matrix protein TasA -
  ACKFA7_RS11595 (ACKFA7_11595) sipW 2462998..2463582 (-) 585 WP_012117977.1 signal peptidase I SipW -
  ACKFA7_RS11600 (ACKFA7_11600) tapA 2463554..2464225 (-) 672 WP_038459173.1 amyloid fiber anchoring/assembly protein TapA -
  ACKFA7_RS11605 (ACKFA7_11605) - 2464484..2464813 (+) 330 WP_038459175.1 DUF3889 domain-containing protein -
  ACKFA7_RS11610 (ACKFA7_11610) - 2464854..2465033 (-) 180 WP_022552966.1 YqzE family protein -
  ACKFA7_RS11615 (ACKFA7_11615) comGG 2465090..2465467 (-) 378 WP_038459177.1 competence type IV pilus minor pilin ComGG Machinery gene
  ACKFA7_RS11620 (ACKFA7_11620) comGF 2465468..2465968 (-) 501 WP_228842201.1 competence type IV pilus minor pilin ComGF -
  ACKFA7_RS11625 (ACKFA7_11625) comGE 2465877..2466191 (-) 315 WP_038459179.1 competence type IV pilus minor pilin ComGE Machinery gene
  ACKFA7_RS11630 (ACKFA7_11630) comGD 2466175..2466612 (-) 438 WP_038459181.1 competence type IV pilus minor pilin ComGD Machinery gene
  ACKFA7_RS11635 (ACKFA7_11635) comGC 2466602..2466910 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  ACKFA7_RS11640 (ACKFA7_11640) comGB 2466915..2467952 (-) 1038 WP_038459183.1 competence type IV pilus assembly protein ComGB Machinery gene
  ACKFA7_RS11645 (ACKFA7_11645) comGA 2467939..2469009 (-) 1071 WP_038459186.1 competence type IV pilus ATPase ComGA Machinery gene
  ACKFA7_RS11650 (ACKFA7_11650) - 2469206..2470156 (-) 951 WP_032874012.1 magnesium transporter CorA family protein -
  ACKFA7_RS11655 (ACKFA7_11655) - 2470302..2471603 (+) 1302 WP_038459188.1 hemolysin family protein -

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16286.82 Da        Isoelectric Point: 10.1850

>NTDB_id=1078149 ACKFA7_RS11630 WP_038459181.1 2466175..2466612(-) (comGD) [Bacillus amyloliquefaciens strain 4-9-2]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPVCTHLAMRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=1078149 ACKFA7_RS11630 WP_038459181.1 2466175..2466612(-) (comGD) [Bacillus amyloliquefaciens strain 4-9-2]
TTGAACAATAACAGGCGGACAGAAAATGGGTTTACCCTTCTTGAAAGCCTGATTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGTCTGCACCCACCTTGCCATGCGGCAAAAAACAGAACAGCTCCAAAAAGATA
TTCAGCTTGCTCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAGGCGGAAGGATTGTCGAGCGTTCTTTTGATTCGCTTCATATTACACTTGTGACTTTACCAGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATTCAATTGAAGAGCGCCGGGTTCACCTATGAGATAACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

54.795

100

0.552


Multiple sequence alignment