Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | ACKFA7_RS11580 | Genome accession | NZ_CP175553 |
| Coordinates | 2461558..2461731 (+) | Length | 57 a.a. |
| NCBI ID | WP_007612543.1 | Uniprot ID | - |
| Organism | Bacillus amyloliquefaciens strain 4-9-2 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2456558..2466731
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACKFA7_RS11565 (ACKFA7_11565) | gcvT | 2457371..2458471 (-) | 1101 | WP_038459167.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| ACKFA7_RS11570 (ACKFA7_11570) | - | 2458895..2460565 (+) | 1671 | WP_038459170.1 | DEAD/DEAH box helicase | - |
| ACKFA7_RS11575 (ACKFA7_11575) | - | 2460587..2461381 (+) | 795 | WP_007612541.1 | YqhG family protein | - |
| ACKFA7_RS11580 (ACKFA7_11580) | sinI | 2461558..2461731 (+) | 174 | WP_007612543.1 | anti-repressor SinI | Regulator |
| ACKFA7_RS11585 (ACKFA7_11585) | sinR | 2461765..2462100 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| ACKFA7_RS11590 (ACKFA7_11590) | tasA | 2462148..2462933 (-) | 786 | WP_003153102.1 | biofilm matrix protein TasA | - |
| ACKFA7_RS11595 (ACKFA7_11595) | sipW | 2462998..2463582 (-) | 585 | WP_012117977.1 | signal peptidase I SipW | - |
| ACKFA7_RS11600 (ACKFA7_11600) | tapA | 2463554..2464225 (-) | 672 | WP_038459173.1 | amyloid fiber anchoring/assembly protein TapA | - |
| ACKFA7_RS11605 (ACKFA7_11605) | - | 2464484..2464813 (+) | 330 | WP_038459175.1 | DUF3889 domain-containing protein | - |
| ACKFA7_RS11610 (ACKFA7_11610) | - | 2464854..2465033 (-) | 180 | WP_022552966.1 | YqzE family protein | - |
| ACKFA7_RS11615 (ACKFA7_11615) | comGG | 2465090..2465467 (-) | 378 | WP_038459177.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| ACKFA7_RS11620 (ACKFA7_11620) | comGF | 2465468..2465968 (-) | 501 | WP_228842201.1 | competence type IV pilus minor pilin ComGF | - |
| ACKFA7_RS11625 (ACKFA7_11625) | comGE | 2465877..2466191 (-) | 315 | WP_038459179.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| ACKFA7_RS11630 (ACKFA7_11630) | comGD | 2466175..2466612 (-) | 438 | WP_038459181.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6672.68 Da Isoelectric Point: 9.8168
>NTDB_id=1078145 ACKFA7_RS11580 WP_007612543.1 2461558..2461731(+) (sinI) [Bacillus amyloliquefaciens strain 4-9-2]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=1078145 ACKFA7_RS11580 WP_007612543.1 2461558..2461731(+) (sinI) [Bacillus amyloliquefaciens strain 4-9-2]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
71.93 |
100 |
0.719 |