Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   ACKFA7_RS11580 Genome accession   NZ_CP175553
Coordinates   2461558..2461731 (+) Length   57 a.a.
NCBI ID   WP_007612543.1    Uniprot ID   -
Organism   Bacillus amyloliquefaciens strain 4-9-2     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2456558..2466731
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACKFA7_RS11565 (ACKFA7_11565) gcvT 2457371..2458471 (-) 1101 WP_038459167.1 glycine cleavage system aminomethyltransferase GcvT -
  ACKFA7_RS11570 (ACKFA7_11570) - 2458895..2460565 (+) 1671 WP_038459170.1 DEAD/DEAH box helicase -
  ACKFA7_RS11575 (ACKFA7_11575) - 2460587..2461381 (+) 795 WP_007612541.1 YqhG family protein -
  ACKFA7_RS11580 (ACKFA7_11580) sinI 2461558..2461731 (+) 174 WP_007612543.1 anti-repressor SinI Regulator
  ACKFA7_RS11585 (ACKFA7_11585) sinR 2461765..2462100 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  ACKFA7_RS11590 (ACKFA7_11590) tasA 2462148..2462933 (-) 786 WP_003153102.1 biofilm matrix protein TasA -
  ACKFA7_RS11595 (ACKFA7_11595) sipW 2462998..2463582 (-) 585 WP_012117977.1 signal peptidase I SipW -
  ACKFA7_RS11600 (ACKFA7_11600) tapA 2463554..2464225 (-) 672 WP_038459173.1 amyloid fiber anchoring/assembly protein TapA -
  ACKFA7_RS11605 (ACKFA7_11605) - 2464484..2464813 (+) 330 WP_038459175.1 DUF3889 domain-containing protein -
  ACKFA7_RS11610 (ACKFA7_11610) - 2464854..2465033 (-) 180 WP_022552966.1 YqzE family protein -
  ACKFA7_RS11615 (ACKFA7_11615) comGG 2465090..2465467 (-) 378 WP_038459177.1 competence type IV pilus minor pilin ComGG Machinery gene
  ACKFA7_RS11620 (ACKFA7_11620) comGF 2465468..2465968 (-) 501 WP_228842201.1 competence type IV pilus minor pilin ComGF -
  ACKFA7_RS11625 (ACKFA7_11625) comGE 2465877..2466191 (-) 315 WP_038459179.1 competence type IV pilus minor pilin ComGE Machinery gene
  ACKFA7_RS11630 (ACKFA7_11630) comGD 2466175..2466612 (-) 438 WP_038459181.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6672.68 Da        Isoelectric Point: 9.8168

>NTDB_id=1078145 ACKFA7_RS11580 WP_007612543.1 2461558..2461731(+) (sinI) [Bacillus amyloliquefaciens strain 4-9-2]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=1078145 ACKFA7_RS11580 WP_007612543.1 2461558..2461731(+) (sinI) [Bacillus amyloliquefaciens strain 4-9-2]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-37)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719


Multiple sequence alignment