Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   ACJGE4_RS12185 Genome accession   NZ_CP174519
Coordinates   2520225..2520602 (-) Length   125 a.a.
NCBI ID   WP_012117980.1    Uniprot ID   -
Organism   Bacillus velezensis strain JD-3     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2515225..2525602
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACJGE4_RS12145 (ACJGE4_12145) - 2515723..2516517 (+) 795 WP_007408330.1 YqhG family protein -
  ACJGE4_RS12150 (ACJGE4_12150) sinI 2516694..2516867 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  ACJGE4_RS12155 (ACJGE4_12155) sinR 2516901..2517236 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  ACJGE4_RS12160 (ACJGE4_12160) tasA 2517284..2518069 (-) 786 WP_407966252.1 biofilm matrix protein TasA -
  ACJGE4_RS12165 (ACJGE4_12165) sipW 2518134..2518718 (-) 585 WP_015240205.1 signal peptidase I SipW -
  ACJGE4_RS12170 (ACJGE4_12170) tapA 2518690..2519361 (-) 672 WP_020954230.1 amyloid fiber anchoring/assembly protein TapA -
  ACJGE4_RS12175 (ACJGE4_12175) - 2519620..2519949 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  ACJGE4_RS12180 (ACJGE4_12180) - 2519989..2520168 (-) 180 WP_003153093.1 YqzE family protein -
  ACJGE4_RS12185 (ACJGE4_12185) comGG 2520225..2520602 (-) 378 WP_012117980.1 competence type IV pilus minor pilin ComGG Machinery gene
  ACJGE4_RS12190 (ACJGE4_12190) comGF 2520603..2521103 (-) 501 WP_257899725.1 competence type IV pilus minor pilin ComGF -
  ACJGE4_RS12195 (ACJGE4_12195) comGE 2521012..2521326 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  ACJGE4_RS12200 (ACJGE4_12200) comGD 2521310..2521747 (-) 438 WP_043020787.1 competence type IV pilus minor pilin ComGD Machinery gene
  ACJGE4_RS12205 (ACJGE4_12205) comGC 2521737..2522003 (-) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  ACJGE4_RS12210 (ACJGE4_12210) comGB 2522050..2523087 (-) 1038 WP_094031834.1 competence type IV pilus assembly protein ComGB Machinery gene
  ACJGE4_RS12215 (ACJGE4_12215) comGA 2523074..2524144 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  ACJGE4_RS12220 (ACJGE4_12220) - 2524338..2525288 (-) 951 WP_007408319.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14195.14 Da        Isoelectric Point: 9.7165

>NTDB_id=1077726 ACJGE4_RS12185 WP_012117980.1 2520225..2520602(-) (comGG) [Bacillus velezensis strain JD-3]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGVLLSSRHMTQGQKVQTGTQRFPYGTVS
FHITGSDRRETVQVTIQAETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=1077726 ACJGE4_RS12185 WP_012117980.1 2520225..2520602(-) (comGG) [Bacillus velezensis strain JD-3]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
GTCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCCGGGGAGTACTGGATCGGAGAGAATCTGCTCCAAAACGGCG
TGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCACGGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACAACGACAGGAACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

51.613

99.2

0.512

Multiple sequence alignment