Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | ACJGE4_RS12150 | Genome accession | NZ_CP174519 |
| Coordinates | 2516694..2516867 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain JD-3 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2511694..2521867
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACJGE4_RS12135 (ACJGE4_12135) | gcvT | 2512507..2513607 (-) | 1101 | WP_099320056.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| ACJGE4_RS12140 (ACJGE4_12140) | - | 2514031..2515701 (+) | 1671 | WP_031378948.1 | DEAD/DEAH box helicase | - |
| ACJGE4_RS12145 (ACJGE4_12145) | - | 2515723..2516517 (+) | 795 | WP_007408330.1 | YqhG family protein | - |
| ACJGE4_RS12150 (ACJGE4_12150) | sinI | 2516694..2516867 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| ACJGE4_RS12155 (ACJGE4_12155) | sinR | 2516901..2517236 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| ACJGE4_RS12160 (ACJGE4_12160) | tasA | 2517284..2518069 (-) | 786 | WP_407966252.1 | biofilm matrix protein TasA | - |
| ACJGE4_RS12165 (ACJGE4_12165) | sipW | 2518134..2518718 (-) | 585 | WP_015240205.1 | signal peptidase I SipW | - |
| ACJGE4_RS12170 (ACJGE4_12170) | tapA | 2518690..2519361 (-) | 672 | WP_020954230.1 | amyloid fiber anchoring/assembly protein TapA | - |
| ACJGE4_RS12175 (ACJGE4_12175) | - | 2519620..2519949 (+) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| ACJGE4_RS12180 (ACJGE4_12180) | - | 2519989..2520168 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| ACJGE4_RS12185 (ACJGE4_12185) | comGG | 2520225..2520602 (-) | 378 | WP_012117980.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| ACJGE4_RS12190 (ACJGE4_12190) | comGF | 2520603..2521103 (-) | 501 | WP_257899725.1 | competence type IV pilus minor pilin ComGF | - |
| ACJGE4_RS12195 (ACJGE4_12195) | comGE | 2521012..2521326 (-) | 315 | WP_012117982.1 | competence type IV pilus minor pilin ComGE | - |
| ACJGE4_RS12200 (ACJGE4_12200) | comGD | 2521310..2521747 (-) | 438 | WP_043020787.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=1077724 ACJGE4_RS12150 WP_003153105.1 2516694..2516867(+) (sinI) [Bacillus velezensis strain JD-3]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=1077724 ACJGE4_RS12150 WP_003153105.1 2516694..2516867(+) (sinI) [Bacillus velezensis strain JD-3]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |