Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   ACJGE4_RS12150 Genome accession   NZ_CP174519
Coordinates   2516694..2516867 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain JD-3     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2511694..2521867
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACJGE4_RS12135 (ACJGE4_12135) gcvT 2512507..2513607 (-) 1101 WP_099320056.1 glycine cleavage system aminomethyltransferase GcvT -
  ACJGE4_RS12140 (ACJGE4_12140) - 2514031..2515701 (+) 1671 WP_031378948.1 DEAD/DEAH box helicase -
  ACJGE4_RS12145 (ACJGE4_12145) - 2515723..2516517 (+) 795 WP_007408330.1 YqhG family protein -
  ACJGE4_RS12150 (ACJGE4_12150) sinI 2516694..2516867 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  ACJGE4_RS12155 (ACJGE4_12155) sinR 2516901..2517236 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  ACJGE4_RS12160 (ACJGE4_12160) tasA 2517284..2518069 (-) 786 WP_407966252.1 biofilm matrix protein TasA -
  ACJGE4_RS12165 (ACJGE4_12165) sipW 2518134..2518718 (-) 585 WP_015240205.1 signal peptidase I SipW -
  ACJGE4_RS12170 (ACJGE4_12170) tapA 2518690..2519361 (-) 672 WP_020954230.1 amyloid fiber anchoring/assembly protein TapA -
  ACJGE4_RS12175 (ACJGE4_12175) - 2519620..2519949 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  ACJGE4_RS12180 (ACJGE4_12180) - 2519989..2520168 (-) 180 WP_003153093.1 YqzE family protein -
  ACJGE4_RS12185 (ACJGE4_12185) comGG 2520225..2520602 (-) 378 WP_012117980.1 competence type IV pilus minor pilin ComGG Machinery gene
  ACJGE4_RS12190 (ACJGE4_12190) comGF 2520603..2521103 (-) 501 WP_257899725.1 competence type IV pilus minor pilin ComGF -
  ACJGE4_RS12195 (ACJGE4_12195) comGE 2521012..2521326 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  ACJGE4_RS12200 (ACJGE4_12200) comGD 2521310..2521747 (-) 438 WP_043020787.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=1077724 ACJGE4_RS12150 WP_003153105.1 2516694..2516867(+) (sinI) [Bacillus velezensis strain JD-3]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=1077724 ACJGE4_RS12150 WP_003153105.1 2516694..2516867(+) (sinI) [Bacillus velezensis strain JD-3]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-37)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702


Multiple sequence alignment