Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   ACJED4_RS02915 Genome accession   NZ_CP174518
Coordinates   592260..592802 (+) Length   180 a.a.
NCBI ID   WP_007497456.1    Uniprot ID   A0A5K1N7D0
Organism   Bacillus altitudinis strain G03     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 544465..594248 592260..592802 within 0


Gene organization within MGE regions


Location: 544465..594248
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACJED4_RS02685 dnaX 544465..546177 (-) 1713 WP_008342013.1 DNA polymerase III subunit gamma/tau -
  ACJED4_RS02695 tadA 546850..547326 (-) 477 WP_008342015.1 tRNA adenosine(34) deaminase TadA -
  ACJED4_RS02700 - 547442..547960 (+) 519 WP_050827655.1 isochorismatase family cysteine hydrolase -
  ACJED4_RS02705 - 548060..549307 (+) 1248 WP_235629394.1 glycoside hydrolase family 18 protein -
  ACJED4_RS02710 - 549387..550010 (+) 624 WP_017366700.1 deoxynucleoside kinase -
  ACJED4_RS02715 - 550007..550666 (+) 660 WP_024719578.1 deoxynucleoside kinase -
  ACJED4_RS02725 - 551136..551468 (-) 333 Protein_503 methyl-accepting chemotaxis protein -
  ACJED4_RS02730 serS 552065..553339 (-) 1275 WP_135227207.1 serine--tRNA ligase -
  ACJED4_RS02735 pdxT 553657..554247 (-) 591 WP_017359015.1 pyridoxal 5'-phosphate synthase glutaminase subunit PdxT -
  ACJED4_RS02740 pdxS 554267..555151 (-) 885 WP_008342033.1 pyridoxal 5'-phosphate synthase lyase subunit PdxS -
  ACJED4_RS02745 - 555398..556876 (+) 1479 WP_407968960.1 PLP-dependent aminotransferase family protein -
  ACJED4_RS02750 - 556919..558244 (-) 1326 WP_035391597.1 D-alanyl-D-alanine carboxypeptidase family protein -
  ACJED4_RS02755 guaB 558405..559871 (-) 1467 WP_008342039.1 IMP dehydrogenase -
  ACJED4_RS02760 - 559993..560961 (+) 969 WP_039962409.1 YaaC family protein -
  ACJED4_RS02790 gyrA 566355..568859 (-) 2505 WP_144626553.1 DNA gyrase subunit A -
  ACJED4_RS02795 gyrB 569093..571009 (-) 1917 WP_025206585.1 DNA topoisomerase (ATP-hydrolyzing) subunit B -
  ACJED4_RS02800 remB 571068..571313 (-) 246 WP_008360920.1 extracellular matrix regulator RemB -
  ACJED4_RS02805 recF 571331..572443 (-) 1113 WP_007497487.1 DNA replication/repair protein RecF Machinery gene
  ACJED4_RS02810 yaaA 572460..572675 (-) 216 WP_008347598.1 S4 domain-containing protein YaaA -
  ACJED4_RS02815 dnaN 572826..573962 (-) 1137 WP_008347596.1 DNA polymerase III subunit beta -
  ACJED4_RS02820 dnaA 574159..575499 (-) 1341 WP_008347594.1 chromosomal replication initiator protein DnaA -
  ACJED4_RS02825 rpmH 576120..576254 (+) 135 WP_008360908.1 50S ribosomal protein L34 -
  ACJED4_RS02830 rnpA 576333..576692 (+) 360 WP_035390150.1 ribonuclease P protein component -
  ACJED4_RS02835 spoIIIJ 576851..577633 (+) 783 WP_089374159.1 YidC family membrane integrase SpoIIIJ -
  ACJED4_RS02840 jag 577630..578253 (+) 624 WP_035390148.1 RNA-binding cell elongation regulator Jag/EloR -
  ACJED4_RS02845 mnmE 578656..580035 (+) 1380 WP_080964592.1 tRNA uridine-5-carboxymethylaminomethyl(34) synthesis GTPase MnmE -
  ACJED4_RS02850 mnmG 580053..581939 (+) 1887 WP_039169033.1 tRNA uridine-5-carboxymethylaminomethyl(34) synthesis enzyme MnmG -
  ACJED4_RS02855 rsmG 581953..582672 (+) 720 WP_007497477.1 16S rRNA (guanine(527)-N(7))-methyltransferase RsmG -
  ACJED4_RS02860 noc 582778..583653 (+) 876 WP_024718432.1 nucleoid occlusion protein -
  ACJED4_RS02865 - 583782..584615 (+) 834 WP_048001990.1 YiiX/YebB-like N1pC/P60 family cysteine hydrolase -
  ACJED4_RS02870 soj 584851..585612 (+) 762 WP_008360890.1 sporulation initiation inhibitor protein Soj -
  ACJED4_RS02875 - 585605..586459 (+) 855 WP_035704116.1 ParB/RepB/Spo0J family partition protein -
  ACJED4_RS02880 yyaC 586485..587111 (-) 627 WP_025208343.1 spore protease YyaC -
  ACJED4_RS02885 - 587184..588239 (+) 1056 WP_080589171.1 hypothetical protein -
  ACJED4_RS02890 - 588265..588675 (-) 411 WP_007497462.1 hypothetical protein -
  ACJED4_RS02895 - 588691..590010 (-) 1320 WP_046526895.1 phage hydrolase -
  ACJED4_RS02900 - 590305..590511 (+) 207 WP_008347561.1 DUF951 domain-containing protein -
  ACJED4_RS02905 ychF 590727..591827 (+) 1101 WP_007497458.1 redox-regulated ATPase YchF -
  ACJED4_RS02910 rpsF 591936..592223 (+) 288 WP_008347557.1 30S ribosomal protein S6 -
  ACJED4_RS02915 ssbA 592260..592802 (+) 543 WP_007497456.1 single-stranded DNA-binding protein SsbA Machinery gene
  ACJED4_RS02920 rpsR 592844..593083 (+) 240 WP_008347556.1 30S ribosomal protein S18 -
  ACJED4_RS02925 - 593283..594248 (+) 966 WP_116306605.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 180 a.a.        Molecular weight: 19605.15 Da        Isoelectric Point: 4.6109

>NTDB_id=1077629 ACJED4_RS02915 WP_007497456.1 592260..592802(+) (ssbA) [Bacillus altitudinis strain G03]
MLNRVVLVGRLTKDPELRYTPNGAAVATFTLAVNRTFTNQSGEREADFINCVTWRRQAENVANFLKKGSLAGVDGRLQTR
NYENQQGQRVFVTEVQAESVQFLEPKSGGAGSGGYSGGGNSGGQYYGGSQNDQNPFGNEPSQNPYGNQNNQNRNQGNSFN
DDPFANDGKPIDISDDDLPF

Nucleotide


Download         Length: 543 bp        

>NTDB_id=1077629 ACJED4_RS02915 WP_007497456.1 592260..592802(+) (ssbA) [Bacillus altitudinis strain G03]
ATGCTAAACCGTGTTGTATTGGTCGGAAGACTAACAAAAGACCCTGAGCTTCGCTACACGCCTAATGGTGCGGCTGTAGC
CACGTTTACTCTAGCTGTGAATCGTACGTTTACGAATCAATCTGGAGAGCGTGAAGCCGATTTCATTAACTGTGTTACTT
GGAGAAGACAAGCCGAGAACGTGGCTAATTTCTTGAAAAAAGGAAGTCTTGCCGGTGTAGACGGTCGCTTGCAGACAAGA
AACTATGAAAACCAGCAAGGACAGCGTGTCTTCGTGACAGAAGTTCAAGCTGAAAGTGTTCAATTTCTTGAGCCTAAAAG
CGGCGGTGCTGGTTCAGGTGGATACAGCGGCGGTGGCAATAGCGGAGGCCAGTATTATGGCGGCAGCCAAAATGATCAGA
ATCCATTTGGAAATGAACCAAGTCAAAATCCATATGGCAATCAAAACAACCAAAATCGTAATCAGGGAAATAGCTTCAAT
GATGACCCATTTGCGAATGATGGTAAACCGATTGACATCTCCGATGATGATTTGCCATTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A5K1N7D0

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

85.556

100

0.856

  ssb Latilactobacillus sakei subsp. sakei 23K

55.376

100

0.572

  ssbB Bacillus subtilis subsp. subtilis str. 168

64.151

58.889

0.378

  ssb Glaesserella parasuis strain SC1401

35.714

100

0.361


Multiple sequence alignment