Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   AABJ90_RS08450 Genome accession   NZ_AP028964
Coordinates   1629277..1629651 (+) Length   124 a.a.
NCBI ID   WP_338382616.1    Uniprot ID   -
Organism   Bacillus subtilis strain NA05 = NBRC 116153     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 1624277..1634651
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AABJ90_RS08415 (BsubNA05_16190) corA 1624348..1625301 (+) 954 WP_338382614.1 magnesium transporter CorA -
  AABJ90_RS08420 (BsubNA05_16200) comGA 1625711..1626781 (+) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  AABJ90_RS08425 (BsubNA05_16210) comGB 1626768..1627805 (+) 1038 WP_338382615.1 comG operon protein ComGB Machinery gene
  AABJ90_RS08430 (BsubNA05_16220) comGC 1627819..1628115 (+) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  AABJ90_RS08435 (BsubNA05_16230) comGD 1628105..1628536 (+) 432 WP_080529538.1 comG operon protein ComGD Machinery gene
  AABJ90_RS08440 (BsubNA05_16240) comGE 1628520..1628867 (+) 348 WP_080529537.1 ComG operon protein 5 Machinery gene
  AABJ90_RS08445 (BsubNA05_16250) comGF 1628893..1629276 (+) 384 WP_080529536.1 ComG operon protein ComGF Machinery gene
  AABJ90_RS08450 (BsubNA05_16260) comGG 1629277..1629651 (+) 375 WP_338382616.1 ComG operon protein ComGG Machinery gene
  AABJ90_RS08455 (BsubNA05_16270) spoIIT 1629723..1629902 (+) 180 WP_029726723.1 YqzE family protein -
  AABJ90_RS08460 (BsubNA05_16280) yqzG 1629944..1630270 (-) 327 WP_003246051.1 YqzG/YhdC family protein -
  AABJ90_RS08465 (BsubNA05_16290) tapA 1630542..1631303 (+) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  AABJ90_RS08470 (BsubNA05_16300) sipW 1631287..1631859 (+) 573 WP_003230181.1 signal peptidase I -
  AABJ90_RS08475 (BsubNA05_16310) tasA 1631923..1632708 (+) 786 WP_161476870.1 biofilm matrix protein TasA -
  AABJ90_RS08480 (BsubNA05_16320) sinR 1632801..1633136 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  AABJ90_RS08485 (BsubNA05_16330) sinI 1633170..1633343 (-) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  AABJ90_RS08490 (BsubNA05_16340) yqhG 1633526..1634320 (-) 795 WP_003230200.1 YqhG family protein -

Sequence

Protein


Download         Length: 124 a.a.        Molecular weight: 14449.68 Da        Isoelectric Point: 8.9758

>NTDB_id=107585 AABJ90_RS08450 WP_338382616.1 1629277..1629651(+) (comGG) [Bacillus subtilis strain NA05 = NBRC 116153]
MYRTRGFIYPAVLFVSALVLLIVNFAAAQYISRCMFEKETKELCIGENLLQNGVLLSIRHVLEERKGQEGTQQFPYGRVS
YYIHDTSIKEQKEINLRVSTESGTERTAQIVFDQKQKKLLRWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=107585 AABJ90_RS08450 WP_338382616.1 1629277..1629651(+) (comGG) [Bacillus subtilis strain NA05 = NBRC 116153]
ATGTATCGTACAAGAGGGTTTATTTATCCAGCTGTTCTTTTTGTGTCAGCGCTTGTGCTGTTAATCGTGAACTTTGCTGC
TGCTCAATATATTTCACGCTGCATGTTTGAGAAGGAAACAAAAGAGTTATGCATAGGAGAGAATTTGCTTCAAAATGGGG
TGCTTCTTTCGATTCGGCATGTTCTAGAGGAACGGAAAGGCCAGGAGGGTACGCAGCAATTTCCATATGGACGGGTTTCT
TATTACATTCATGATACATCGATAAAAGAACAAAAAGAAATCAACTTAAGAGTGTCAACGGAGTCGGGAACAGAAAGAAC
TGCACAGATCGTGTTTGATCAAAAACAGAAAAAACTGCTGAGATGGACAGAATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

96.774

100

0.968

Multiple sequence alignment