Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   AABJ90_RS08485 Genome accession   NZ_AP028964
Coordinates   1633170..1633343 (-) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain NA05 = NBRC 116153     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 1628170..1638343
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AABJ90_RS08440 (BsubNA05_16240) comGE 1628520..1628867 (+) 348 WP_080529537.1 ComG operon protein 5 Machinery gene
  AABJ90_RS08445 (BsubNA05_16250) comGF 1628893..1629276 (+) 384 WP_080529536.1 ComG operon protein ComGF Machinery gene
  AABJ90_RS08450 (BsubNA05_16260) comGG 1629277..1629651 (+) 375 WP_338382616.1 ComG operon protein ComGG Machinery gene
  AABJ90_RS08455 (BsubNA05_16270) spoIIT 1629723..1629902 (+) 180 WP_029726723.1 YqzE family protein -
  AABJ90_RS08460 (BsubNA05_16280) yqzG 1629944..1630270 (-) 327 WP_003246051.1 YqzG/YhdC family protein -
  AABJ90_RS08465 (BsubNA05_16290) tapA 1630542..1631303 (+) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  AABJ90_RS08470 (BsubNA05_16300) sipW 1631287..1631859 (+) 573 WP_003230181.1 signal peptidase I -
  AABJ90_RS08475 (BsubNA05_16310) tasA 1631923..1632708 (+) 786 WP_161476870.1 biofilm matrix protein TasA -
  AABJ90_RS08480 (BsubNA05_16320) sinR 1632801..1633136 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  AABJ90_RS08485 (BsubNA05_16330) sinI 1633170..1633343 (-) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  AABJ90_RS08490 (BsubNA05_16340) yqhG 1633526..1634320 (-) 795 WP_003230200.1 YqhG family protein -
  AABJ90_RS08495 (BsubNA05_16350) yqhH 1634341..1636014 (-) 1674 WP_003230203.1 SNF2-related protein -
  AABJ90_RS08500 (BsubNA05_16360) gcvT 1636455..1637543 (+) 1089 WP_015714248.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=107587 AABJ90_RS08485 WP_003230187.1 1633170..1633343(-) (sinI) [Bacillus subtilis strain NA05 = NBRC 116153]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=107587 AABJ90_RS08485 WP_003230187.1 1633170..1633343(-) (sinI) [Bacillus subtilis strain NA05 = NBRC 116153]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment