Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | AABJ90_RS08485 | Genome accession | NZ_AP028964 |
| Coordinates | 1633170..1633343 (-) | Length | 57 a.a. |
| NCBI ID | WP_003230187.1 | Uniprot ID | A0A063X7W9 |
| Organism | Bacillus subtilis strain NA05 = NBRC 116153 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 1628170..1638343
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AABJ90_RS08440 (BsubNA05_16240) | comGE | 1628520..1628867 (+) | 348 | WP_080529537.1 | ComG operon protein 5 | Machinery gene |
| AABJ90_RS08445 (BsubNA05_16250) | comGF | 1628893..1629276 (+) | 384 | WP_080529536.1 | ComG operon protein ComGF | Machinery gene |
| AABJ90_RS08450 (BsubNA05_16260) | comGG | 1629277..1629651 (+) | 375 | WP_338382616.1 | ComG operon protein ComGG | Machinery gene |
| AABJ90_RS08455 (BsubNA05_16270) | spoIIT | 1629723..1629902 (+) | 180 | WP_029726723.1 | YqzE family protein | - |
| AABJ90_RS08460 (BsubNA05_16280) | yqzG | 1629944..1630270 (-) | 327 | WP_003246051.1 | YqzG/YhdC family protein | - |
| AABJ90_RS08465 (BsubNA05_16290) | tapA | 1630542..1631303 (+) | 762 | WP_029726724.1 | amyloid fiber anchoring/assembly protein TapA | - |
| AABJ90_RS08470 (BsubNA05_16300) | sipW | 1631287..1631859 (+) | 573 | WP_003230181.1 | signal peptidase I | - |
| AABJ90_RS08475 (BsubNA05_16310) | tasA | 1631923..1632708 (+) | 786 | WP_161476870.1 | biofilm matrix protein TasA | - |
| AABJ90_RS08480 (BsubNA05_16320) | sinR | 1632801..1633136 (-) | 336 | WP_003226345.1 | transcriptional regulator SinR | Regulator |
| AABJ90_RS08485 (BsubNA05_16330) | sinI | 1633170..1633343 (-) | 174 | WP_003230187.1 | anti-repressor SinI family protein | Regulator |
| AABJ90_RS08490 (BsubNA05_16340) | yqhG | 1633526..1634320 (-) | 795 | WP_003230200.1 | YqhG family protein | - |
| AABJ90_RS08495 (BsubNA05_16350) | yqhH | 1634341..1636014 (-) | 1674 | WP_003230203.1 | SNF2-related protein | - |
| AABJ90_RS08500 (BsubNA05_16360) | gcvT | 1636455..1637543 (+) | 1089 | WP_015714248.1 | glycine cleavage system aminomethyltransferase GcvT | - |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6601.52 Da Isoelectric Point: 6.7231
>NTDB_id=107587 AABJ90_RS08485 WP_003230187.1 1633170..1633343(-) (sinI) [Bacillus subtilis strain NA05 = NBRC 116153]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=107587 AABJ90_RS08485 WP_003230187.1 1633170..1633343(-) (sinI) [Bacillus subtilis strain NA05 = NBRC 116153]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
100 |
100 |
1 |