Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   ACCH06_RS15920 Genome accession   NZ_CP174157
Coordinates   3189039..3189182 (-) Length   47 a.a.
NCBI ID   WP_003327149.1    Uniprot ID   -
Organism   Bacillus atrophaeus strain SHZ-24     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3184039..3194182
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACCH06_RS15895 - 3184361..3184741 (-) 381 WP_199679676.1 hotdog fold thioesterase -
  ACCH06_RS15900 comA 3184759..3185400 (-) 642 WP_003327154.1 response regulator transcription factor Regulator
  ACCH06_RS15905 comP 3185481..3187787 (-) 2307 WP_406589206.1 two-component system sensor histidine kinase ComP Regulator
  ACCH06_RS15910 comX 3187801..3187968 (-) 168 WP_106033957.1 competence pheromone ComX Regulator
  ACCH06_RS15915 comQ 3187952..3188854 (-) 903 WP_106034023.1 polyprenyl synthetase family protein Regulator
  ACCH06_RS15920 degQ 3189039..3189182 (-) 144 WP_003327149.1 degradation enzyme regulation protein DegQ Regulator
  ACCH06_RS15925 - 3189642..3190001 (+) 360 WP_343310885.1 hypothetical protein -
  ACCH06_RS15930 - 3190020..3191252 (-) 1233 WP_406589207.1 EAL and HDOD domain-containing protein -
  ACCH06_RS15935 - 3191390..3192856 (-) 1467 WP_088117879.1 nicotinate phosphoribosyltransferase -
  ACCH06_RS15940 - 3192872..3193423 (-) 552 WP_406589208.1 cysteine hydrolase family protein -
  ACCH06_RS15945 - 3193531..3193929 (-) 399 WP_003327144.1 YueI family protein -

Sequence

Protein


Download         Length: 47 a.a.        Molecular weight: 5645.61 Da        Isoelectric Point: 8.5787

>NTDB_id=1074703 ACCH06_RS15920 WP_003327149.1 3189039..3189182(-) (degQ) [Bacillus atrophaeus strain SHZ-24]
MEKKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKFTYAMKIS

Nucleotide


Download         Length: 144 bp        

>NTDB_id=1074703 ACCH06_RS15920 WP_003327149.1 3189039..3189182(-) (degQ) [Bacillus atrophaeus strain SHZ-24]
GTGGAAAAGAAAAAACTTGAAGAAGTGAAACAATTATTATTCCGACTCGAACTTGATATCAAAGAAACGACAGATTCATT
ACGAAACATTAACAAAAGCATTGATCAGCTCGATAAATTCACATATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-47)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

95.455

93.617

0.894

Multiple sequence alignment