Detailed information    

insolico Bioinformatically predicted

Overview

Name   comX   Type   Regulator
Locus tag   ACCH06_RS15910 Genome accession   NZ_CP174157
Coordinates   3187801..3187968 (-) Length   55 a.a.
NCBI ID   WP_106033957.1    Uniprot ID   -
Organism   Bacillus atrophaeus strain SHZ-24     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context

Location: 3182801..3192968
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACCH06_RS15880 - 3183204..3183680 (+) 477 WP_094232698.1 Na+/H+ antiporter subunit E -
  ACCH06_RS15885 - 3183680..3183964 (+) 285 WP_094232699.1 Na(+)/H(+) antiporter subunit F1 -
  ACCH06_RS15890 mnhG 3183948..3184322 (+) 375 WP_061570550.1 monovalent cation/H(+) antiporter subunit G -
  ACCH06_RS15895 - 3184361..3184741 (-) 381 WP_199679676.1 hotdog fold thioesterase -
  ACCH06_RS15900 comA 3184759..3185400 (-) 642 WP_003327154.1 response regulator transcription factor Regulator
  ACCH06_RS15905 comP 3185481..3187787 (-) 2307 WP_406589206.1 two-component system sensor histidine kinase ComP Regulator
  ACCH06_RS15910 comX 3187801..3187968 (-) 168 WP_106033957.1 competence pheromone ComX Regulator
  ACCH06_RS15915 comQ 3187952..3188854 (-) 903 WP_106034023.1 polyprenyl synthetase family protein Regulator
  ACCH06_RS15920 degQ 3189039..3189182 (-) 144 WP_003327149.1 degradation enzyme regulation protein DegQ Regulator
  ACCH06_RS15925 - 3189642..3190001 (+) 360 WP_343310885.1 hypothetical protein -
  ACCH06_RS15930 - 3190020..3191252 (-) 1233 WP_406589207.1 EAL and HDOD domain-containing protein -
  ACCH06_RS15935 - 3191390..3192856 (-) 1467 WP_088117879.1 nicotinate phosphoribosyltransferase -

Sequence

Protein


Download         Length: 55 a.a.        Molecular weight: 6568.44 Da        Isoelectric Point: 4.6094

>NTDB_id=1074701 ACCH06_RS15910 WP_106033957.1 3187801..3187968(-) (comX) [Bacillus atrophaeus strain SHZ-24]
MQDLINYFLNYPEVLKKLKNKEACLIGFDLDETQTILKAYDDYHLSAQRTREWDG

Nucleotide


Download         Length: 168 bp        

>NTDB_id=1074701 ACCH06_RS15910 WP_106033957.1 3187801..3187968(-) (comX) [Bacillus atrophaeus strain SHZ-24]
ATGCAAGATCTAATTAATTACTTTTTAAATTATCCTGAAGTATTAAAAAAATTGAAAAATAAAGAAGCTTGCCTTATAGG
TTTTGATTTAGACGAAACTCAAACAATACTTAAAGCTTACGATGATTATCATCTGTCTGCTCAAAGAACTCGTGAATGGG
ACGGTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

77.358

96.364

0.745

Multiple sequence alignment