Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   ACJED3_RS21090 Genome accession   NZ_CP174155
Coordinates   3962468..3962842 (+) Length   124 a.a.
NCBI ID   WP_014480253.1    Uniprot ID   A0AA96ZSW7
Organism   Bacillus subtilis strain G01     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 3957468..3967842
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACJED3_RS21050 corA 3957538..3958491 (+) 954 WP_014480260.1 magnesium transporter CorA -
  ACJED3_RS21055 - 3958493..3958690 (+) 198 WP_014480259.1 CBS domain-containing protein -
  ACJED3_RS21060 comGA 3958902..3959972 (+) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  ACJED3_RS21065 comGB 3959959..3960996 (+) 1038 WP_031600685.1 comG operon protein ComGB Machinery gene
  ACJED3_RS21070 comGC 3961010..3961306 (+) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  ACJED3_RS21075 comGD 3961296..3961727 (+) 432 WP_014480256.1 comG operon protein ComGD Machinery gene
  ACJED3_RS21080 comGE 3961711..3962058 (+) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  ACJED3_RS21085 comGF 3962084..3962467 (+) 384 WP_014480254.1 ComG operon protein ComGF Machinery gene
  ACJED3_RS21090 comGG 3962468..3962842 (+) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  ACJED3_RS21095 spoIITA 3962913..3963092 (+) 180 WP_014480252.1 YqzE family protein -
  ACJED3_RS21100 yqzG 3963134..3963460 (-) 327 WP_003246051.1 YqzG/YhdC family protein -
  ACJED3_RS21105 tapA 3963732..3964493 (+) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  ACJED3_RS21110 sipW 3964477..3965049 (+) 573 WP_003230181.1 signal peptidase I SipW -
  ACJED3_RS21115 tasA 3965113..3965898 (+) 786 WP_014480250.1 biofilm matrix protein TasA -
  ACJED3_RS21120 sinR 3965991..3966326 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  ACJED3_RS21125 sinI 3966360..3966533 (-) 174 WP_003230187.1 anti-repressor SinI Regulator
  ACJED3_RS21130 yqhG 3966716..3967510 (-) 795 WP_014480249.1 YqhG family protein -

Sequence

Protein


Download         Length: 124 a.a.        Molecular weight: 14509.72 Da        Isoelectric Point: 9.2806

>NTDB_id=1074632 ACJED3_RS21090 WP_014480253.1 3962468..3962842(+) (comGG) [Bacillus subtilis strain G01]
MYRTRGFIYPAVLFVSALVLLIVNFAAAQYISRCMFEKETKELYIGENLLQNGVLLSIRHVLEERKGQEGTQQFPYGRVS
YYIHDTSIKEQKEINLRVSTESGTERTAQIVFDQKQKKLLRWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=1074632 ACJED3_RS21090 WP_014480253.1 3962468..3962842(+) (comGG) [Bacillus subtilis strain G01]
ATGTATCGTACAAGAGGGTTTATTTATCCAGCTGTTCTTTTTGTGTCAGCGCTTGTGCTGTTAATCGTGAACTTTGCTGC
TGCTCAATATATTTCACGCTGCATGTTTGAAAAGGAAACAAAAGAGTTATACATAGGAGAGAATTTGCTTCAAAATGGGG
TGCTTCTTTCGATTCGGCATGTTCTAGAGGAACGGAAAGGCCAGGAGGGTACGCAGCAATTTCCATATGGACGGGTTTCT
TATTACATTCATGATACATCGATAAAAGAACAAAAAGAAATCAACTTAAGAGTGTCAACGGAGTCGGGAACAGAAAGAAC
TGCACAGATCGTATTTGATCAAAAACAGAAAAAACTGCTGAGATGGACAGAATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

97.581

100

0.976

Multiple sequence alignment