Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   ACJED3_RS21125 Genome accession   NZ_CP174155
Coordinates   3966360..3966533 (-) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain G01     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 3961360..3971533
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACJED3_RS21080 comGE 3961711..3962058 (+) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  ACJED3_RS21085 comGF 3962084..3962467 (+) 384 WP_014480254.1 ComG operon protein ComGF Machinery gene
  ACJED3_RS21090 comGG 3962468..3962842 (+) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  ACJED3_RS21095 spoIITA 3962913..3963092 (+) 180 WP_014480252.1 YqzE family protein -
  ACJED3_RS21100 yqzG 3963134..3963460 (-) 327 WP_003246051.1 YqzG/YhdC family protein -
  ACJED3_RS21105 tapA 3963732..3964493 (+) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  ACJED3_RS21110 sipW 3964477..3965049 (+) 573 WP_003230181.1 signal peptidase I SipW -
  ACJED3_RS21115 tasA 3965113..3965898 (+) 786 WP_014480250.1 biofilm matrix protein TasA -
  ACJED3_RS21120 sinR 3965991..3966326 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  ACJED3_RS21125 sinI 3966360..3966533 (-) 174 WP_003230187.1 anti-repressor SinI Regulator
  ACJED3_RS21130 yqhG 3966716..3967510 (-) 795 WP_014480249.1 YqhG family protein -
  ACJED3_RS21135 hepAA 3967531..3969204 (-) 1674 WP_014480248.1 DEAD/DEAH box helicase -
  ACJED3_RS21140 gcvT 3969646..3970734 (+) 1089 WP_014480247.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=1074634 ACJED3_RS21125 WP_003230187.1 3966360..3966533(-) (sinI) [Bacillus subtilis strain G01]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=1074634 ACJED3_RS21125 WP_003230187.1 3966360..3966533(-) (sinI) [Bacillus subtilis strain G01]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment