Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   AABA74_RS12140 Genome accession   NZ_AP028932
Coordinates   2495431..2495868 (-) Length   145 a.a.
NCBI ID   WP_044053464.1    Uniprot ID   -
Organism   Bacillus velezensis strain RB.IBE29     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2490431..2500868
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AABA74_RS12090 (RBIBE_23260) sinI 2490816..2490989 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  AABA74_RS12095 (RBIBE_23270) sinR 2491023..2491358 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  AABA74_RS12100 (RBIBE_23280) - 2491406..2492191 (-) 786 WP_003153102.1 TasA family protein -
  AABA74_RS12105 (RBIBE_23290) - 2492255..2492839 (-) 585 WP_046559873.1 signal peptidase I -
  AABA74_RS12110 (RBIBE_23300) tapA 2492811..2493482 (-) 672 WP_046559874.1 amyloid fiber anchoring/assembly protein TapA -
  AABA74_RS12115 (RBIBE_23310) - 2493741..2494070 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  AABA74_RS12120 (RBIBE_23320) - 2494110..2494289 (-) 180 WP_003153093.1 YqzE family protein -
  AABA74_RS12125 (RBIBE_23330) comGG 2494346..2494723 (-) 378 WP_046559875.1 competence type IV pilus minor pilin ComGG Machinery gene
  AABA74_RS12130 (RBIBE_23340) comGF 2494724..2495119 (-) 396 WP_046559876.1 competence type IV pilus minor pilin ComGF -
  AABA74_RS12135 (RBIBE_23350) comGE 2495133..2495447 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  AABA74_RS12140 (RBIBE_23360) comGD 2495431..2495868 (-) 438 WP_044053464.1 competence type IV pilus minor pilin ComGD Machinery gene
  AABA74_RS12145 (RBIBE_23370) comGC 2495858..2496166 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  AABA74_RS12150 (RBIBE_23380) comGB 2496171..2497208 (-) 1038 WP_014305414.1 competence type IV pilus assembly protein ComGB Machinery gene
  AABA74_RS12155 (RBIBE_23390) comGA 2497195..2498265 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  AABA74_RS12160 (RBIBE_23400) - 2498457..2499407 (-) 951 WP_003153082.1 magnesium transporter CorA family protein -
  AABA74_RS12165 (RBIBE_23410) - 2499553..2500854 (+) 1302 WP_058906187.1 hemolysin family protein -

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16282.81 Da        Isoelectric Point: 10.3354

>NTDB_id=107428 AABA74_RS12140 WP_044053464.1 2495431..2495868(-) (comGD) [Bacillus velezensis strain RB.IBE29]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPVCTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIRLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=107428 AABA74_RS12140 WP_044053464.1 2495431..2495868(-) (comGD) [Bacillus velezensis strain RB.IBE29]
TTGAACAATAACAGGCGGACAGAAAACGGGTTTACTCTTCTTGAAAGCCTGATTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGTCTGCACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTTCAAAAAGATA
TTCAGCTTGCGCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAGGCGGTAGGATTGTCGAGCGTTCTTTTGATTCGCTTCACATTACACTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATTCGATTGAAGAGCGCCGGGTTCACCTATGAGATCACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

56.164

100

0.566


Multiple sequence alignment